NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097121

Metagenome / Metatranscriptome Family F097121

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097121
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 37 residues
Representative Sequence MNGFFDIKSPNWLGGVNVHNTLALVGIGFLVYKAMKK
Number of Associated Samples 87
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 18.27 %
% of genes from short scaffolds (< 2000 bps) 53.85 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (47.115 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(51.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(57.692 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.46%    β-sheet: 0.00%    Coil/Unstructured: 61.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00534Glycos_transf_1 12.50
PF06414Zeta_toxin 6.73
PF00535Glycos_transf_2 4.81
PF13578Methyltransf_24 2.88
PF13692Glyco_trans_1_4 1.92
PF13392HNH_3 1.92
PF13489Methyltransf_23 1.92
PF09524Phg_2220_C 1.92
PF01541GIY-YIG 0.96
PF11195DUF2829 0.96
PF01555N6_N4_Mtase 0.96
PF10111Glyco_tranf_2_2 0.96
PF00132Hexapep 0.96
PF04383KilA-N 0.96
PF02767DNA_pol3_beta_2 0.96
PF13443HTH_26 0.96
PF00892EamA 0.96
PF01464SLT 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 0.96
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.96
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.96
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.88 %
UnclassifiedrootN/A47.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000405|LV_Brine_h2_0102DRAFT_1000535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum13175Open in IMG/M
3300000558|Draft_10274976All Organisms → cellular organisms → Bacteria4520Open in IMG/M
3300000882|FwDRAFT_10183648Not Available556Open in IMG/M
3300000929|NpDRAFT_10412175All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1201Open in IMG/M
3300002408|B570J29032_109003613Not Available564Open in IMG/M
3300002408|B570J29032_109739235All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300002408|B570J29032_109742736Not Available1184Open in IMG/M
3300002408|B570J29032_109946914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4425Open in IMG/M
3300005512|Ga0074648_1000206All Organisms → cellular organisms → Bacteria77527Open in IMG/M
3300005517|Ga0070374_10422412Not Available669Open in IMG/M
3300005527|Ga0068876_10026771Not Available3611Open in IMG/M
3300005581|Ga0049081_10000213All Organisms → cellular organisms → Bacteria22939Open in IMG/M
3300005581|Ga0049081_10122671Not Available961Open in IMG/M
3300005662|Ga0078894_10066506All Organisms → cellular organisms → Bacteria3101Open in IMG/M
3300005662|Ga0078894_10117781Not Available2360Open in IMG/M
3300005662|Ga0078894_11672179Not Available523Open in IMG/M
3300005942|Ga0070742_10014167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tijeunavirus → Tijeunavirus TJE12089Open in IMG/M
3300006752|Ga0098048_1010523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)3280Open in IMG/M
3300007216|Ga0103961_1035812All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium6345Open in IMG/M
3300007542|Ga0099846_1094354Not Available1105Open in IMG/M
3300007634|Ga0102901_1205613Not Available554Open in IMG/M
3300007973|Ga0105746_1000224All Organisms → cellular organisms → Bacteria15455Open in IMG/M
3300007973|Ga0105746_1159524Not Available762Open in IMG/M
3300008267|Ga0114364_1013353All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium5670Open in IMG/M
3300008267|Ga0114364_1016671All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium3164Open in IMG/M
3300009049|Ga0102911_1234669Not Available515Open in IMG/M
3300009059|Ga0102830_1099377Not Available863Open in IMG/M
3300009082|Ga0105099_10299624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Schleiferiaceae → Croceimicrobium → Croceimicrobium hydrocarbonivorans942Open in IMG/M
3300009151|Ga0114962_10003363Not Available12989Open in IMG/M
3300009151|Ga0114962_10118382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1627Open in IMG/M
3300009152|Ga0114980_10186852Not Available1221Open in IMG/M
3300009154|Ga0114963_10205430Not Available1138Open in IMG/M
3300009154|Ga0114963_10306920Not Available882Open in IMG/M
3300009155|Ga0114968_10016591All Organisms → cellular organisms → Bacteria5148Open in IMG/M
3300009155|Ga0114968_10057572All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300009155|Ga0114968_10223954Not Available1080Open in IMG/M
3300009168|Ga0105104_10737136Not Available568Open in IMG/M
3300009181|Ga0114969_10581814Not Available616Open in IMG/M
3300009183|Ga0114974_10002403Not Available14360Open in IMG/M
3300009496|Ga0115570_10403146All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)581Open in IMG/M
3300009526|Ga0115004_10308947All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)938Open in IMG/M
3300009684|Ga0114958_10577965Not Available538Open in IMG/M
3300010160|Ga0114967_10439342Not Available645Open in IMG/M
3300010316|Ga0136655_1037036All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1563Open in IMG/M
3300010389|Ga0136549_10009872All Organisms → cellular organisms → Bacteria6459Open in IMG/M
3300010885|Ga0133913_10417999Not Available3543Open in IMG/M
3300011268|Ga0151620_1088467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes985Open in IMG/M
3300011268|Ga0151620_1151444Not Available713Open in IMG/M
3300012346|Ga0157141_1004746Not Available2238Open in IMG/M
3300012667|Ga0157208_10000018Not Available52379Open in IMG/M
3300013004|Ga0164293_10108112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium2124Open in IMG/M
(restricted) 3300013127|Ga0172365_10095406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1903Open in IMG/M
3300017968|Ga0181587_10304237All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium1074Open in IMG/M
3300018603|Ga0192881_1002260Not Available1603Open in IMG/M
3300019784|Ga0181359_1006558All Organisms → cellular organisms → Bacteria3894Open in IMG/M
3300019784|Ga0181359_1018052All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300020347|Ga0211504_1004808All Organisms → Viruses → Predicted Viral4763Open in IMG/M
3300020498|Ga0208050_1003111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)2149Open in IMG/M
3300020532|Ga0208601_1003608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)2476Open in IMG/M
3300020573|Ga0208485_1010413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2093Open in IMG/M
3300021093|Ga0194123_10043853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3019Open in IMG/M
3300021438|Ga0213920_1005976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4340Open in IMG/M
3300021961|Ga0222714_10021737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4988Open in IMG/M
3300022190|Ga0181354_1066937Not Available1192Open in IMG/M
3300022407|Ga0181351_1174775Not Available746Open in IMG/M
3300022752|Ga0214917_10002285Not Available23584Open in IMG/M
3300022752|Ga0214917_10090279All Organisms → Viruses → Predicted Viral1830Open in IMG/M
3300023174|Ga0214921_10520763Not Available558Open in IMG/M
3300023184|Ga0214919_10690317Not Available581Open in IMG/M
(restricted) 3300023276|Ga0233410_10057482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1170Open in IMG/M
3300023301|Ga0209414_1004012All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)6328Open in IMG/M
(restricted) 3300024519|Ga0255046_10333149Not Available713Open in IMG/M
3300025759|Ga0208899_1068735Not Available1427Open in IMG/M
3300025818|Ga0208542_1041187Not Available1467Open in IMG/M
3300025874|Ga0209533_1011080All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)7008Open in IMG/M
3300027142|Ga0255065_1084171Not Available538Open in IMG/M
3300027151|Ga0255063_1002778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tijeunavirus → Tijeunavirus TJE14335Open in IMG/M
3300027586|Ga0208966_1015097Not Available2288Open in IMG/M
3300027693|Ga0209704_1251200All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027697|Ga0209033_1091003Not Available1015Open in IMG/M
3300027708|Ga0209188_1005011Not Available8627Open in IMG/M
3300027712|Ga0209499_1024667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2732Open in IMG/M
3300027749|Ga0209084_1310856Not Available590Open in IMG/M
3300027759|Ga0209296_1006510All Organisms → cellular organisms → Bacteria7348Open in IMG/M
(restricted) 3300027881|Ga0255055_10800047Not Available501Open in IMG/M
3300027963|Ga0209400_1081611Not Available1558Open in IMG/M
3300028392|Ga0304729_1006314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6045Open in IMG/M
3300028394|Ga0304730_1181695Not Available814Open in IMG/M
3300031758|Ga0315907_10228435All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300032401|Ga0315275_11897112Not Available630Open in IMG/M
3300033981|Ga0334982_0474338Not Available557Open in IMG/M
3300033995|Ga0335003_0009300All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)5102Open in IMG/M
3300034012|Ga0334986_0010720All Organisms → cellular organisms → Bacteria6576Open in IMG/M
3300034012|Ga0334986_0209888All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300034061|Ga0334987_0004858Not Available12850Open in IMG/M
3300034061|Ga0334987_0329785All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)997Open in IMG/M
3300034064|Ga0335001_0172153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium1217Open in IMG/M
3300034073|Ga0310130_0000159All Organisms → cellular organisms → Bacteria58498Open in IMG/M
3300034093|Ga0335012_0338461All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)752Open in IMG/M
3300034096|Ga0335025_0038072All Organisms → cellular organisms → Bacteria3221Open in IMG/M
3300034104|Ga0335031_0739463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium559Open in IMG/M
3300034122|Ga0335060_0373539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium761Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake19.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.81%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.88%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.92%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.92%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.92%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.92%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline1.92%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.96%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.96%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.96%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.96%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.96%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.96%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.96%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.96%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000405Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micronEnvironmentalOpen in IMG/M
3300000558Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300007216Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012346Freshwater microbial communities from Emily Creek, Ontario, Canada - S29EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020532Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023301Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes)EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LV_Brine_h2_0102DRAFT_1000535233300000405HypersalineMNDLFDIQSPNYLGGNNVHNTLALLGIGFLVYCAVKKK*
Draft_1027497633300000558Hydrocarbon Resource EnvironmentsMGAGFFDIKSPNWLGGNNVHNTLILVGVAYLVYKSM*
FwDRAFT_1018364813300000882Freshwater And MarineMGQGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK*
NpDRAFT_1041217523300000929Freshwater And MarineMDGLFDIKSSKWLGGNNVHNTLALVGIALLVYKAYK*
B570J29032_10900361313300002408FreshwaterMGDFLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYK*
B570J29032_10973923523300002408FreshwaterMFQGFFDIKSDKWLGGVNVHNTLTLVGIGILVFKAMKK*
B570J29032_10974273623300002408FreshwaterMFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKAWKK*
B570J29032_10994691423300002408FreshwaterMGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYSK*
Ga0074648_1000206273300005512Saline Water And SedimentMNGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR*
Ga0070374_1042241213300005517Freshwater LakeMGTGFLDIKSPNWLGGNNVHNTLALIGIGYLVFKAMKK*
Ga0068876_1002677123300005527Freshwater LakeMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK*
Ga0049081_10000213273300005581Freshwater LenticMGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK*
Ga0049081_1012267123300005581Freshwater LenticMSGFLDIKSPNYLGGVNVHNTLALLGIGYLVYKAMKK*
Ga0078894_1006650683300005662Freshwater LakeMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVYKAMRK*
Ga0078894_1011778123300005662Freshwater LakeMGTGFLDIKSPNWLGGNNVHNTLIIAGVAYLVWKAMKK*
Ga0078894_1167217913300005662Freshwater LakeMGTGFFDIKSPNWLGGVNVHNTLALLGIGFLVFKAMKKA*
Ga0070742_1001416713300005942EstuarineMNGFFDIKSPNWLGGVNVHNTVTIALLAYLVYKNR*
Ga0098048_101052383300006752MarineMDNLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK*
Ga0103961_103581283300007216Freshwater LakeMEGFFDIKSPNWLGGNNVHNTVIILGVGYLVWKAWSK*
Ga0099846_109435413300007542AqueousNGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR*
Ga0102901_120561333300007634EstuarineLTYKKMTGFFDIKSPNWLGGTNVHNTLALIGIAYLVYKTAK*
Ga0105746_100022433300007973Estuary WaterMSGFFDIKSPNWLGGVNVHNTLALIGIGYLVYKAMRK*
Ga0105746_115952413300007973Estuary WaterSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK*
Ga0114364_101335393300008267Freshwater, PlanktonMFQGFFDIKSDKWLGGVNVHNTLALLGIGYLVYKAMKK*
Ga0114364_101667143300008267Freshwater, PlanktonMGTGFFDIKSPNWLGGVNVHNTLALLGIGFLVFKAMKKG*
Ga0102911_123466913300009049EstuarineKKMTGFFDIKSPNWLGGTNVHNTLALIGIAYLVYKTAK*
Ga0102830_109937723300009059EstuarineMGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK*
Ga0105099_1029962423300009082Freshwater SedimentMGAGFFDIKSANWLGGNNVHNTLIIAGVAFLVYKAYKK*
Ga0114962_1000336383300009151Freshwater LakeMTGVLDIKSPNWLFGNNVHNTLIILGVGFLVWKAVKK*
Ga0114962_1011838243300009151Freshwater LakeMGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK*
Ga0114980_1018685223300009152Freshwater LakeMAQGFFDIKSPNWLGGVNVHNTLALVGIYFLVYKAMKK*
Ga0114963_1020543023300009154Freshwater LakeMLNGFLDIKSDKWLGGVNVHNTLALLGIGYLVFKAMKK*
Ga0114963_1030692023300009154Freshwater LakeMGAGFFDIKSPNWLGGTNVHNTLALVGFGYLVYKAWGK*
Ga0114968_1001659153300009155Freshwater LakeMGTGYFDIKSPNWLGGVNVHNTLALIGIGFLVFKALKK*
Ga0114968_1005757223300009155Freshwater LakeMKDGFLDIKSPNWLGGVNVHNTLALIGIGFLVFKAWKK*
Ga0114968_1022395423300009155Freshwater LakeMEGLFDIKSPNWLGGVNVHNTLALVGIGYLVYKAWKS*
Ga0105104_1073713623300009168Freshwater SedimentMGSGFFDIKSPNWLGGNNVHNTIIILGVGYLVYKAWGK*
Ga0114969_1058181423300009181Freshwater LakeMGDLFNIKSANYLGGVNVHNTLALAGIAYLVYKAYSK*
Ga0114974_1000240333300009183Freshwater LakeMSDFFNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK*
Ga0115570_1040314623300009496Pelagic MarineMDGVFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK*
Ga0115004_1030894723300009526MarineMTGLFDIKSPNWLGGNNVHNTLALAGIGFLVFKALKK*
Ga0114958_1057796513300009684Freshwater LakeMKQGFFDISSPSWLGGVNVHNTLALLGIGFLVYKAVKK*
Ga0114967_1043934223300010160Freshwater LakeMGFSLDIKSPDYLGGVNFHNTVTIALLAFLVYKAVKK*
Ga0136655_103703633300010316Freshwater To Marine Saline GradientMNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR*
Ga0136549_1000987243300010389Marine Methane Seep SedimentMQGLFDIKSDNWLGGNNVHNTLTIAMLAFLVYKQVKK*
Ga0133913_1041799923300010885Freshwater LakeMGSDFFNIKSPNWLGGTNVHNTLALVGIYYLVYKAYTK*
Ga0151620_108846713300011268FreshwaterLNLKAMGNGFFDIKSPNWLGGNNAHNTLIILGVGYLVFKSLKK*
Ga0151620_115144433300011268FreshwaterFLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK*
Ga0157141_100474613300012346FreshwaterMGAGFFDIKSANWLGGNNVHNTLIIAGVAFLVYKAYKR*
Ga0157208_10000018813300012667FreshwaterMGAGFFDIKSANWLGGVNVHNTVTIGLLAFLVYKAVKK*
Ga0164293_1010811223300013004FreshwaterMGAGFFDIKSPNWLGGNNVHNTLIILGVAFLVYKAAK*
(restricted) Ga0172365_1009540623300013127SedimentMGDFFNIKSDKWLGGVNVHNTLALVGIYYLVYKAWSK*
(restricted) Ga0172364_1053945823300013129SedimentMKDLFNINSDKWLGGNNVHNTVIILGVGYLVFKAWSKK*
(restricted) Ga0172362_1069076123300013133SedimentMKDLFNINSDKWLGGNNVHNTVIILGVGYLVFKAWS
Ga0181587_1030423733300017968Salt MarshMNGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR
Ga0192881_100226043300018603MarineIMDGLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK
Ga0181359_100655813300019784Freshwater LakeMGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK
Ga0181359_101805233300019784Freshwater LakeMGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAMAK
Ga0211504_100480833300020347MarineMDGLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK
Ga0208050_100311123300020498FreshwaterMGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK
Ga0208601_100360823300020532FreshwaterMGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYSK
Ga0208485_101041313300020573FreshwaterMGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYK
Ga0194123_1004385323300021093Freshwater LakeMGDFFNIKSDKWLGGVNVHNTLALIGIYYLVYKAWSK
Ga0213920_100597643300021438FreshwaterMGAGFFDIKSPNWLGGTNVHNTLALIGIGYLVYKAWGK
Ga0222714_1002173723300021961Estuarine WaterMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK
Ga0181354_106693713300022190Freshwater LakeNSKIMFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKAWKK
Ga0181351_117477523300022407Freshwater LakeMGDLFNIKSANYLGGVNVHNTLALAGIAYLVYKAYSK
Ga0214917_1000228543300022752FreshwaterMNGFFDIKSPNWLGGVNVHNTLALVGIGFLVYKAMKK
Ga0214917_1009027923300022752FreshwaterMGTGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKAYKG
Ga0214921_1052076323300023174FreshwaterMGTGFFDIKSPNWLGGVNVHNTLALVGIGFLVFKALKK
Ga0214919_1069031713300023184FreshwaterMSGFLDIKSPNYLGGVNVHNTLALLGIGYLVYKAMKK
(restricted) Ga0233410_1005748223300023276SeawaterMTGLFDIKSPNWLGGNNVHNTLALAGIGFLVFKALKK
Ga0209414_100401283300023301HypersalineMNDLFDIQSPNYLGGNNVHNTLALLGIGFLVYCAVKKK
(restricted) Ga0255046_1033314913300024519SeawaterIMDGLFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK
Ga0208899_106873533300025759AqueousKLMNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR
Ga0208542_104118713300025818AqueousMNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR
Ga0209533_1011080143300025874Pelagic MarineMDGVFDIKSTKWLGGNNVHNTLALVGIALLVYKAYK
Ga0255065_108417113300027142FreshwaterGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK
Ga0255063_100277833300027151FreshwaterMNGFFDIKSPNWLGGVNVHNTVTIALLAYLVYKNR
Ga0208966_101509723300027586Freshwater LenticMGTGFLDIKSPNWLGGNNVHNTLALIGIGYLVFKAMKK
Ga0209704_125120023300027693Freshwater SedimentMGAGFFDIKSANWLGGTNVHNTLALLGIGYLVFKAYKK
Ga0209033_109100323300027697Freshwater LakePLNVEIMQSGFFDIKSPNWLGGNNVHNTLVILGVGFLVYKAWKK
Ga0209188_1005011163300027708Freshwater LakeMTGVLDIKSPNWLFGNNVHNTLIILGVGFLVWKAVKK
Ga0209499_102466733300027712Freshwater LakeMGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK
Ga0209084_131085633300027749Freshwater LakeGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK
Ga0209296_100651023300027759Freshwater LakeMGNGFFDIKSPNWLGGNNVHNTIIILGVGYLVYKAWGK
(restricted) Ga0255055_1080004713300027881SeawaterDGLFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK
Ga0209400_108161123300027963Freshwater LakeMGTGYFDIKSPNWLGGVNVHNTLALIGIGFLVFKALKK
Ga0304729_1006314103300028392Freshwater LakeMLNGFLDIKSDKWLGGVNVHNTLALLGIGYLVFKAMKK
Ga0304730_118169513300028394Freshwater LakeMKDGFLDIKSPNWLGGVNVHNTLALIGIGFLVFKAWKK
Ga0315907_1022843523300031758FreshwaterMGFSLDIKSPDYLGGVNFHNTVTIALLAFLVYKAVKK
Ga0315275_1189711223300032401SedimentAMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK
Ga0334982_0474338_311_4183300033981FreshwaterMKEFFNINSDKWLGGVNVHNTITIALLAYLVYKNR
Ga0335003_0009300_4124_42343300033995FreshwaterMSDFLNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK
Ga0334986_0010720_4911_50183300034012FreshwaterMKEFFNINSDKWLGGVNVHNTITIALLGYIVYKLR
Ga0334986_0209888_735_8513300034012FreshwaterMFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVFKAMKK
Ga0334987_0004858_2355_24623300034061FreshwaterMGDFFNINSDKWLGGVNVHNTITIALLAYLVYKNR
Ga0334987_0329785_622_7293300034061FreshwaterMQDFFNINSDKWLGGVNVHNTITIALLAYLVYKTR
Ga0335001_0172153_931_10443300034064FreshwaterMGDFFNIKSDKWLGGVNVHNTLALVGIYYLVYKAWGK
Ga0310130_0000159_53984_540913300034073Fracking WaterMGDFFNINSDKWLGGVNVHNTITIALLGYLVYKLR
Ga0335012_0338461_640_7503300034093FreshwaterMSDFFNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK
Ga0335025_0038072_2257_23733300034096FreshwaterMGAGFFDIKSANWLGGVNVHNTLTISLLAFLVYKVVKK
Ga0335031_0739463_1_1053300034104FreshwaterMFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKA
Ga0335060_0373539_2_1063300034122FreshwaterMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.