Basic Information | |
---|---|
Family ID | F097225 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | MDNVTFIEVDGVEHAIIDRGNGEFTSMLKSTYDEQQAANVINEL |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 96.77 % |
% of genes near scaffold ends (potentially truncated) | 5.77 % |
% of genes from short scaffolds (< 2000 bps) | 11.54 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.115 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.115 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.615 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.808 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.44% β-sheet: 26.39% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF13539 | Peptidase_M15_4 | 19.23 |
PF03406 | Phage_fiber_2 | 5.77 |
PF05257 | CHAP | 4.81 |
PF02018 | CBM_4_9 | 2.88 |
PF03354 | TerL_ATPase | 0.96 |
PF13692 | Glyco_trans_1_4 | 0.96 |
PF01391 | Collagen | 0.96 |
PF13155 | Toprim_2 | 0.96 |
PF13252 | DUF4043 | 0.96 |
PF04586 | Peptidase_S78 | 0.96 |
PF01844 | HNH | 0.96 |
PF13506 | Glyco_transf_21 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.96 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.12 % |
All Organisms | root | All Organisms | 27.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10018115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2624 | Open in IMG/M |
3300006639|Ga0079301_1000119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39119 | Open in IMG/M |
3300008108|Ga0114341_10092853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1849 | Open in IMG/M |
3300008116|Ga0114350_1000405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27495 | Open in IMG/M |
3300009082|Ga0105099_10315754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300009161|Ga0114966_10023867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4590 | Open in IMG/M |
3300009175|Ga0073936_10281637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
3300009419|Ga0114982_1000877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15689 | Open in IMG/M |
3300010885|Ga0133913_10841183 | Not Available | 2388 | Open in IMG/M |
3300011114|Ga0151515_10672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14404 | Open in IMG/M |
3300019784|Ga0181359_1192454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300020048|Ga0207193_1025392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7138 | Open in IMG/M |
3300020159|Ga0211734_10935358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300020161|Ga0211726_10340982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300022407|Ga0181351_1002405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6495 | Open in IMG/M |
3300025383|Ga0208250_1044590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300027114|Ga0208009_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39098 | Open in IMG/M |
3300027710|Ga0209599_10000937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15693 | Open in IMG/M |
3300027764|Ga0209134_10012592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2590 | Open in IMG/M |
3300027797|Ga0209107_10014448 | All Organisms → Viruses → Predicted Viral | 4488 | Open in IMG/M |
3300027808|Ga0209354_10167722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300028025|Ga0247723_1012106 | All Organisms → Viruses → Predicted Viral | 3262 | Open in IMG/M |
3300028025|Ga0247723_1063784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
3300028025|Ga0247723_1150151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300031952|Ga0315294_10125570 | Not Available | 2631 | Open in IMG/M |
3300031999|Ga0315274_10155178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2899 | Open in IMG/M |
3300034050|Ga0335023_0009370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5735 | Open in IMG/M |
3300034061|Ga0334987_0561498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300034062|Ga0334995_0065156 | All Organisms → Viruses → Predicted Viral | 2894 | Open in IMG/M |
3300034106|Ga0335036_0183628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
3300034107|Ga0335037_0008168 | All Organisms → cellular organisms → Bacteria | 5570 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.12% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.35% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 13.46% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 4.81% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.81% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.92% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.96% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.96% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.96% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100181152 | 3300000756 | Freshwater And Sediment | MDNVKFIDMTDVFTGDVITHAIIDRGNGEFTSMLKSTYDEQQAQQLGGN* |
JGI12421J11937_100375863 | 3300000756 | Freshwater And Sediment | MDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPSLPE* |
JGI12421J11937_100710211 | 3300000756 | Freshwater And Sediment | MDNVKFIKIIGSDGIEVEHAIIDRGNGEFTSMLKSTYDEQQASLRLVT |
JGI24028J26656_10028106 | 3300002091 | Lentic | MDKVTFTKDTDGVEYATIDRGNNEFTSMLKSTYDQQQAANAK* |
B570J29032_1087960621 | 3300002408 | Freshwater | MENITYITDEQGVEHVVIDRGNGEYTSMLKFTYDEQQAALNGNKL* |
B570J40625_1008982031 | 3300002835 | Freshwater | MDKVTFIEDDKSVSHAIIDRGNGEFTSMLKSTYDEQQASVSD* |
JGI25913J50563_10219722 | 3300003431 | Freshwater Lake | MDTVTFIEVEELGGVVEHAIIDRGNGEFTSMTKAHYEALQDQAGE* |
Ga0049082_102845431 | 3300005584 | Freshwater Lentic | CKMDNVNFNTDERGIEYATIDHGNGAFTSMLKSTYDEQQAEQSTPSLPA* |
Ga0079301_100011924 | 3300006639 | Deep Subsurface | MDNVTFIEIDGLEHAIIDHGNEQFTSMLKSTYDALLEEQANDQSL* |
Ga0075467_103522412 | 3300006803 | Aqueous | MDNVTFITVDEVEHAIIDRGNGEYTSMPKATYDDMQAALSTPNV* |
Ga0102861_10203163 | 3300007544 | Estuarine | MDKVTFIEITDPLTKNVTEYAIIDHGNEKFSSMLKSTYDELKAND* |
Ga0105746_10146442 | 3300007973 | Estuary Water | MDKVTFIEITDPLTKNVTEYAIIDHGDEKFSSMLKSTYDELKAND* |
Ga0114341_100928534 | 3300008108 | Freshwater, Plankton | MDNVDFVTDEKGIEHAIIDRGNGEYTSMLKSTYDEQQAALDNGNLL* |
Ga0114343_10570323 | 3300008110 | Freshwater, Plankton | MDNVSFITVTNQLTNEVVEHAIIDRGNGEFTSMTKATYDAQQAKVGN* |
Ga0114350_100040523 | 3300008116 | Freshwater, Plankton | MENVTFIEIETLGGVETHAIIDRGNGEFTSMLKSTYDEMQARQLGGN* |
Ga0102860_12144572 | 3300009056 | Estuarine | MKMDNVTYVTIDEVEHAIIDRGNGEFTSMLKSTYDEQQAALSTPSV* |
Ga0105099_103157542 | 3300009082 | Freshwater Sediment | MENVTFINVENLDGIIEHAIIDHGNGQYTSMLKSVYDEQQAAALNAHKL* |
Ga0114980_106403962 | 3300009152 | Freshwater Lake | MDNVTFVTDKDGVEHAIIDRGNGEFTSMLKSTYDEQQAALSTPIVTSDE* |
Ga0114977_100545563 | 3300009158 | Freshwater Lake | MDKVTYITVNDVEHAIIDRGNEEFTSMLKSTYDEQQAALSTPSV* |
Ga0114966_1002386710 | 3300009161 | Freshwater Lake | MKNVTYLIDKDGNEHAIIDHGNGEFTSMLKSTYDEQQAALSRPMVTDAPES* |
Ga0073936_102816371 | 3300009175 | Freshwater Lake Hypolimnion | MDNVTFIKVTGTDGVEVEHAIIDRGNGEFTSMLKSTYDAQQAT |
Ga0114974_100774134 | 3300009183 | Freshwater Lake | MDNVKFIKVIDSIGAEVEHAIIDRGNGEFTSMLKSTYDEQQAQQLGGN* |
Ga0114974_101477622 | 3300009183 | Freshwater Lake | MDNVTFIEVEGVEHAIIDRGNGEFTSMTKAHYEELQVAPTP* |
Ga0114976_103334202 | 3300009184 | Freshwater Lake | MSDVTFFTDELGNEHAIIDRGNGEYTSMLKSTYDEQQAQQLGGN* |
Ga0114982_100087716 | 3300009419 | Deep Subsurface | MDNVTFIEVEGVEHAIIDRGNGEFTSMTKAHYEAQLANEAETI* |
Ga0133913_104657343 | 3300010885 | Freshwater Lake | MDNVTFIKVAGIDGTEVEHAIIDRGDGEFTSMTKEHYDKQLEESSN* |
Ga0133913_108411833 | 3300010885 | Freshwater Lake | MDNVTYVTDTNGVEHAIIDHGNGEYTSMLKSTYDEQQAALSTP |
Ga0151515_1067213 | 3300011114 | Freshwater | MEKVQFVKITNPLNDEVTEHAIIDRGNGEFTSMLKSIYDEQQKAMTIDEPAAKSK* |
Ga0119955_10285893 | 3300012006 | Freshwater | MRMDNVIFVIVDEVEHAIIDRGNGEYTSMPKSFYESQQLALSTPIINAD* |
Ga0164293_100995492 | 3300013004 | Freshwater | MDKVTFIEVETLGGVQTHAIIDRGNGEFTSMLKSTYDEQQAALNDFNEL* |
Ga0164292_101476212 | 3300013005 | Freshwater | MDKVTFIEVETLGGVQTHAIIDRGNGEFTSMTKATYDEQQAALNDFNEL* |
Ga0177922_108061002 | 3300013372 | Freshwater | MGNVTFLTRTNIDGTEVEHAIIDRGNGEFTSMLKSTYDA |
Ga0181364_10708341 | 3300017701 | Freshwater Lake | MDNVNFNTDERGIEYATIDHGNGAFTSMLKSTYDEQQAALSTPSLPA |
Ga0181350_10876782 | 3300017716 | Freshwater Lake | MTMDNVTFVFDSNGTEHAIIDHGNGEYTSMTKSFYDAQQAALSTPIISGDE |
Ga0181362_11253781 | 3300017723 | Freshwater Lake | MTMDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPSLPA |
Ga0181365_10223032 | 3300017736 | Freshwater Lake | MDNVTFVFDSNGTEHAIIDHGNGEYTSMTKSFYDAQQAALSTPIISGDE |
Ga0181365_10728351 | 3300017736 | Freshwater Lake | MDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPSLPA |
Ga0181356_12241552 | 3300017761 | Freshwater Lake | MENVTYFTDSLGVEHAIIDRGNGEFTSMLKSTYEAMQANYLTP |
Ga0181358_10262741 | 3300017774 | Freshwater Lake | MENVTFITITNSEDLEIEHAIIDRGNGEYTSMLKSTYDA |
Ga0181358_10672591 | 3300017774 | Freshwater Lake | MDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPS |
Ga0181355_12938512 | 3300017785 | Freshwater Lake | MDNVTVVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPSLPE |
Ga0181359_10735252 | 3300019784 | Freshwater Lake | MDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPSLPE |
Ga0181359_11924541 | 3300019784 | Freshwater Lake | MDNVSFIKVTQPMTGEILEHAIIDRGNGEFTSMLKSTYEAH |
Ga0207193_10253924 | 3300020048 | Freshwater Lake Sediment | MDNVTFIDDANGVKHVIIDRGNGEFTSMTKERYDELEAAKENANKL |
Ga0207193_11103535 | 3300020048 | Freshwater Lake Sediment | MSNVNFIKSEVDETEYAIIDRGNGEFTSMLKSTYDAM |
Ga0211734_106023752 | 3300020159 | Freshwater | MDNVTFITDFQGLEHAIIDRGNGEFTSMLKSTYDEMQANADKL |
Ga0211734_109353582 | 3300020159 | Freshwater | MNNVTFIKITGMDGVDVEHAIIDRGNGEFTSMLKSTYDEQQAQQLGGN |
Ga0211726_103409822 | 3300020161 | Freshwater | MDNVTFIEMTDAFGNKSTHAIIDRGNGEYTSMLKSTYDEQLAAQSANKL |
Ga0211729_104120982 | 3300020172 | Freshwater | MENVEFIFIDEVEHAIIDRGNGEYTSMLKSTYDEQQAALSTPIVSSDE |
Ga0211729_113645342 | 3300020172 | Freshwater | MDNVTFIEITDPLTNEVVEHAVIDHGNDKFTSMLKSTYDEQQAAE |
Ga0214207_10406211 | 3300020716 | Freshwater | MDKVSFIEVEGVEHAIIDRGNGEFTSMPKANYDAQQAS |
Ga0181351_10024056 | 3300022407 | Freshwater Lake | MDKVIFVEVDAAGVIQTHAIIDRGNGEFTSMLKSTYDAQQAALADE |
Ga0214921_101890952 | 3300023174 | Freshwater | MNNVTFIEIANPMTEEVVEHAIIDRGNGEFTSMTKAHYEELQAAQAQTATI |
Ga0214921_102163022 | 3300023174 | Freshwater | VDNVTFIQTTNPMTEEVVEHAIIDRGNGEFTSMTKEHYEELQAAQAQTATI |
Ga0214919_100456252 | 3300023184 | Freshwater | MDNVIFVIVDEVEHAIIDRGNGEYTSMPKSFYESQQLALSTPIINAD |
Ga0214919_101517642 | 3300023184 | Freshwater | MDNVTFIEVESMGQMITHAIIDRGNGEYTSMLKSTYDEQQKANDSKS |
Ga0208250_10445901 | 3300025383 | Freshwater | MDNVTFIDVTNENGDITQNVIIDRGNGNFTSMLKSTYDAQQSAST |
Ga0208009_100003053 | 3300027114 | Deep Subsurface | MDNVTFIEIDGLEHAIIDHGNEQFTSMLKSTYDALLEEQANDQSL |
Ga0209599_1000093711 | 3300027710 | Deep Subsurface | MDNVTFIEVEGVEHAIIDRGNGEFTSMTKAHYEAQLANEAETI |
Ga0209596_10416614 | 3300027754 | Freshwater Lake | MKNVTYLIDKDGNEHAIIDHGNGEFTSMLKSTYDEQQAALSRPMVTDAPES |
Ga0209134_100125925 | 3300027764 | Freshwater Lake | MDTVTFIEVEELGGVVEHAIIDRGNGEFTSMTKAHYEALQDQAGE |
Ga0209770_103495331 | 3300027769 | Freshwater Lake | MDNVTFIEVKDFMTGKIVEHAIIDRGNGEYTSMIKSTYDE |
Ga0209972_102556671 | 3300027793 | Freshwater Lake | MDNVTFIKNTDPITGEVIEHAIIDRGNGEFTSMLKSTY |
Ga0209107_100144482 | 3300027797 | Freshwater And Sediment | MDNVKFIDMTDVFTGDVITHAIIDRGNGEFTSMLKSTYDEQQAQQLGGN |
Ga0209107_101828882 | 3300027797 | Freshwater And Sediment | MENVTFIEVETLEGTETHAVIDRGNGEFSSMPKSVYDAQQEAIKP |
Ga0209354_101677221 | 3300027808 | Freshwater Lake | MDKVTFVTDEQGVEHAIIDRGNEEFTSMTKAHYDAMQAEQSTPSV |
Ga0209191_12516132 | 3300027969 | Freshwater Lake | MNNVTFIEVESHGVVETHAIIDRGNGEYTSMPKSVYDEQQA |
Ga0209298_101013752 | 3300027973 | Freshwater Lake | MDNVTFVTDKDGVEHAIIDRGNGEFTSMLKSTYDEQQAALSTPIVTSDE |
Ga0247723_10121064 | 3300028025 | Deep Subsurface Sediment | MNNVIFITDNDGFEHAIIDRGNGEFTSMLKSTYDAQLEEQANDQSL |
Ga0247723_10327103 | 3300028025 | Deep Subsurface Sediment | MDNVTFIKRIGIDSTEIEHAIIDRGNGEFTSMLKSTYDKQQAQTNVN |
Ga0247723_10557692 | 3300028025 | Deep Subsurface Sediment | MDKVTFIDVEAFGEVETHAIIDHGNGEYTSMSKSIYDQLAANEAAPK |
Ga0247723_10637842 | 3300028025 | Deep Subsurface Sediment | MSNVTFIEIETMSGKETHAIIDRGNGEFTSMLKSTYDEQQAKQLGGN |
Ga0247723_11501512 | 3300028025 | Deep Subsurface Sediment | MNNVTFITDEQGVEHAIIDRGNGEFTSMTKAHYEAQLANEAETK |
Ga0315291_104784622 | 3300031707 | Sediment | MDKVTFIEVETLGGVETHAIIDRGNGEFTSMSKATYDEQQAANELNEL |
Ga0315291_106190902 | 3300031707 | Sediment | MDKVTFIEVNDVEYAIIDRGNGQFTSMTKTTYDEQQAADELNKL |
Ga0315291_106360332 | 3300031707 | Sediment | MEKIKISKFTDLDGIEYEQVVIDRGNGEFTSMLKSTYDEQQAANVINEL |
Ga0315293_106884272 | 3300031746 | Sediment | MDKVTFIKVTDPLTNEEIEHAIIDRGNGEFTSMLKSTYDEQQAANVINEL |
Ga0315288_111402421 | 3300031772 | Sediment | MDNVTFIEVDGVEHAIIDRGNGEFTSMLKSTYDEQQAANVINEL |
Ga0315288_116641982 | 3300031772 | Sediment | MDKVTFIEVETLGGVETHAIIDRGNNEFTSMSKATYDEQQAANELNEL |
Ga0315285_108319141 | 3300031885 | Sediment | MDKVMFIKVTDPLTNEEIEHAIIDRGNGEFTSMLKSTYDEQQAANVINEL |
Ga0315294_101255701 | 3300031952 | Sediment | MDKVTFIEVNDVEYAIIDRGNGQFTSMTKATYDEQQAADELNKL |
Ga0315294_108762393 | 3300031952 | Sediment | MDNVTFIEVNDVEYAIIDRGNGQFTSMTKATYDEQQAADELNKL |
Ga0315274_101551783 | 3300031999 | Sediment | MKMDKVTFIEVETLGGVETHAIIDRGNGEFTSMSKATYDEQQAANELNEL |
Ga0315274_120371552 | 3300031999 | Sediment | MTMDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYDEQQ |
Ga0315289_113210432 | 3300032046 | Sediment | MDKVTFITDRLGDEHAIIDRGNGEFTSMLKSTYDEQQAKALNGD |
Ga0315277_101387583 | 3300032118 | Sediment | MDNVTFIEVDGVEHAIIDRGNGEFTSMMKSTYDEQQAANVINEL |
Ga0315286_101956455 | 3300032342 | Sediment | MDNVTFIEVDGVEHAIIDRGNGEFTSMLKSTYDEQQAANEANEL |
Ga0334996_0257422_401_523 | 3300033994 | Freshwater | MDNVTFIEIDGETHAIIDRGNGEFTSMLKSTYDAMQVDGD |
Ga0334986_0404745_109_264 | 3300034012 | Freshwater | MTMDKVTFVEVETLGGVETHAIIDRGNGEFTSMSKATYEAQLAANEAINEL |
Ga0335023_0009370_788_943 | 3300034050 | Freshwater | MDNVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPMVTDAPKS |
Ga0334987_0561498_494_640 | 3300034061 | Freshwater | MDNVSFISMTNLGGVEVEHAIIDRGNGEYTSMLKSTYDEQQAQQLGGN |
Ga0334995_0065156_2_115 | 3300034062 | Freshwater | DEQGVEHVVIDRGNGEYTSMLKFTYDEQQAALNGNKL |
Ga0335019_0046825_2156_2302 | 3300034066 | Freshwater | MDNVTIVFNEVMGELIETVLIDKGNGEFTSMLKSTYDEQQANTVTLEA |
Ga0335019_0253362_198_344 | 3300034066 | Freshwater | MDNVTFIEIETLSGVQIHAIIDRGNGEFTSMLKSTYDEQQANTVTLEA |
Ga0335028_0085623_974_1123 | 3300034071 | Freshwater | MDKVTFIELENLNGKWEHAIIDRGNGEFTSMLKSTYDAQQEAIANDQSL |
Ga0335010_0219061_656_793 | 3300034092 | Freshwater | MENITYITDEQGVEHVVIDRGNGEYTSMLKFTYDEQQAALNGNKL |
Ga0335010_0455489_1_117 | 3300034092 | Freshwater | TFIEDDKSVSHAIIDRGNGEFTSMLKSTYDEQQASVSD |
Ga0335010_0675900_210_347 | 3300034092 | Freshwater | MDKVSFITVDEVEHAIIDRGNGEFTSMTKAHYEELEAAKANASEL |
Ga0335027_0118945_1312_1461 | 3300034101 | Freshwater | MENVTFIEVETLNGVETHAIIDRGNGEFTSMPKATYDEQQAAILNAPKL |
Ga0335036_0183628_589_717 | 3300034106 | Freshwater | MDKVTFIEDDKSVSHAIIDRGNGEFTSMLKSTYDEQQASVSN |
Ga0335037_0008168_4302_4454 | 3300034107 | Freshwater | MENVTFVTIDEVEHAIIDRGNGEFTSMLRSTYETQQATLSTPMVTDAPKS |
Ga0335053_0444347_149_283 | 3300034118 | Freshwater | MDKVTFIEDDKSVSHAIIDRGNGEFTSMLKSTYDEQQASVSDKL |
Ga0335065_0670748_60_215 | 3300034200 | Freshwater | MDKVTFVTDEQGVEHAIIDRGNGEYTSMQKTTYEAQQAALSTPMVTDAPKS |
Ga0335007_0220434_781_906 | 3300034283 | Freshwater | MNVTFIKIEGVEHAIIDRGNGEFTSMLKSTYDAMQTEVTND |
⦗Top⦘ |