NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097329

Metagenome / Metatranscriptome Family F097329

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097329
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 89 residues
Representative Sequence MAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Number of Associated Samples 83
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 7.69 %
% of genes near scaffold ends (potentially truncated) 30.77 %
% of genes from short scaffolds (< 2000 bps) 79.81 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (54.808 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(26.923 % of family members)
Environment Ontology (ENVO) Unclassified
(61.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(97.115 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.53%    β-sheet: 6.78%    Coil/Unstructured: 51.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF05136Phage_portal_2 20.19
PF05876GpA_ATPase 12.50
PF01343Peptidase_S49 6.73
PF00574CLP_protease 1.92
PF14743DNA_ligase_OB_2 1.92
PF09722Xre_MbcA_ParS_C 0.96
PF00565SNase 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 20.19
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 17.31
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 12.50
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 3.85
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A54.81 %
All OrganismsrootAll Organisms45.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10019605All Organisms → Viruses → Predicted Viral3247Open in IMG/M
3300000115|DelMOSum2011_c10030796All Organisms → Viruses → Predicted Viral2375Open in IMG/M
3300000115|DelMOSum2011_c10066774Not Available1320Open in IMG/M
3300000115|DelMOSum2011_c10158571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.664Open in IMG/M
3300000115|DelMOSum2011_c10187112Not Available586Open in IMG/M
3300000115|DelMOSum2011_c10216169Not Available525Open in IMG/M
3300003620|JGI26273J51734_10002195All Organisms → cellular organisms → Bacteria9951Open in IMG/M
3300005941|Ga0070743_10069628All Organisms → Viruses → Predicted Viral1191Open in IMG/M
3300005942|Ga0070742_10018824All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300006029|Ga0075466_1124310All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae682Open in IMG/M
3300006029|Ga0075466_1154557Not Available588Open in IMG/M
3300006484|Ga0070744_10077814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae962Open in IMG/M
3300006752|Ga0098048_1050934All Organisms → Viruses → Predicted Viral1301Open in IMG/M
3300006789|Ga0098054_1141139All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Haloferula → unclassified Haloferula → Haloferula sp. BvORR071892Open in IMG/M
3300006789|Ga0098054_1350561Not Available524Open in IMG/M
3300006793|Ga0098055_1025490All Organisms → Viruses → Predicted Viral2487Open in IMG/M
3300006793|Ga0098055_1314738Not Available584Open in IMG/M
3300006802|Ga0070749_10063425All Organisms → Viruses → Predicted Viral2226Open in IMG/M
3300006802|Ga0070749_10214890All Organisms → Viruses → Predicted Viral1098Open in IMG/M
3300006802|Ga0070749_10250022All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae1004Open in IMG/M
3300006803|Ga0075467_10212955All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Haloferula → unclassified Haloferula → Haloferula sp. BvORR0711068Open in IMG/M
3300006803|Ga0075467_10400026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae715Open in IMG/M
3300006803|Ga0075467_10476473Not Available643Open in IMG/M
3300006803|Ga0075467_10629032Not Available548Open in IMG/M
3300006810|Ga0070754_10139634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae1167Open in IMG/M
3300006916|Ga0070750_10008529All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Haloferula → unclassified Haloferula → Haloferula sp. BvORR0715466Open in IMG/M
3300006919|Ga0070746_10258806Not Available810Open in IMG/M
3300006920|Ga0070748_1326047Not Available544Open in IMG/M
3300006924|Ga0098051_1191999Not Available535Open in IMG/M
3300007229|Ga0075468_10134613Not Available758Open in IMG/M
3300007276|Ga0070747_1239445Not Available632Open in IMG/M
3300007345|Ga0070752_1130460All Organisms → Viruses → Predicted Viral1048Open in IMG/M
3300007540|Ga0099847_1198648Not Available585Open in IMG/M
3300007552|Ga0102818_1061047Not Available743Open in IMG/M
3300007655|Ga0102825_1043493Not Available916Open in IMG/M
3300007681|Ga0102824_1130420Not Available661Open in IMG/M
3300007692|Ga0102823_1146786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.627Open in IMG/M
3300007981|Ga0102904_1109299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.646Open in IMG/M
3300008999|Ga0102816_1033353All Organisms → Viruses → Predicted Viral1508Open in IMG/M
3300009003|Ga0102813_1070277Not Available1148Open in IMG/M
3300009074|Ga0115549_1023766All Organisms → Viruses → Predicted Viral2393Open in IMG/M
3300009080|Ga0102815_10550805Not Available646Open in IMG/M
3300009149|Ga0114918_10149907Not Available1393Open in IMG/M
3300009423|Ga0115548_1155440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167719Open in IMG/M
3300009496|Ga0115570_10482890Not Available518Open in IMG/M
3300009606|Ga0115102_10059818Not Available1238Open in IMG/M
3300010430|Ga0118733_107782317Not Available555Open in IMG/M
3300017697|Ga0180120_10122832All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300017697|Ga0180120_10409055Not Available532Open in IMG/M
3300017752|Ga0181400_1036976All Organisms → Viruses → Predicted Viral1553Open in IMG/M
3300017951|Ga0181577_10583355Not Available691Open in IMG/M
3300018416|Ga0181553_10357538Not Available801Open in IMG/M
3300020166|Ga0206128_1001907All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium19637Open in IMG/M
3300020166|Ga0206128_1235880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.681Open in IMG/M
3300020182|Ga0206129_10017172All Organisms → cellular organisms → Bacteria5905Open in IMG/M
3300020185|Ga0206131_10328552Not Available670Open in IMG/M
3300020187|Ga0206130_10098732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1725Open in IMG/M
3300021365|Ga0206123_10112430Not Available1285Open in IMG/M
3300021378|Ga0213861_10564771Not Available529Open in IMG/M
3300021957|Ga0222717_10050955All Organisms → Viruses → Predicted Viral2683Open in IMG/M
3300022061|Ga0212023_1009152All Organisms → Viruses → Predicted Viral1251Open in IMG/M
3300022061|Ga0212023_1036866Not Available680Open in IMG/M
3300022178|Ga0196887_1037126Not Available1316Open in IMG/M
3300022202|Ga0224498_10238864Not Available541Open in IMG/M
(restricted) 3300023276|Ga0233410_10008237All Organisms → Viruses → Predicted Viral2808Open in IMG/M
3300023567|Ga0228694_134894Not Available521Open in IMG/M
3300023568|Ga0228696_1039629Not Available537Open in IMG/M
3300023693|Ga0232112_1000132All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5607Open in IMG/M
3300023694|Ga0228683_1029540Not Available599Open in IMG/M
3300023702|Ga0232119_1000320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5683Open in IMG/M
3300024180|Ga0228668_1000371Not Available19793Open in IMG/M
3300024267|Ga0228623_1071301Not Available652Open in IMG/M
3300024326|Ga0228652_1020868All Organisms → Viruses → Predicted Viral1907Open in IMG/M
3300024335|Ga0228672_1051797Not Available1281Open in IMG/M
3300024343|Ga0244777_10453514Not Available793Open in IMG/M
3300024346|Ga0244775_10074647All Organisms → Viruses → Predicted Viral2903Open in IMG/M
3300024346|Ga0244775_10597276Not Available896Open in IMG/M
3300024346|Ga0244775_11249687Not Available577Open in IMG/M
3300024415|Ga0228662_1036782All Organisms → Viruses → Predicted Viral1300Open in IMG/M
3300025084|Ga0208298_1006890All Organisms → Viruses → Predicted Viral3041Open in IMG/M
3300025108|Ga0208793_1015255All Organisms → Viruses → Predicted Viral2850Open in IMG/M
3300025543|Ga0208303_1098531Not Available621Open in IMG/M
3300025590|Ga0209195_1094048Not Available671Open in IMG/M
3300025594|Ga0209094_1006023All Organisms → cellular organisms → Bacteria5061Open in IMG/M
3300025594|Ga0209094_1115769Not Available594Open in IMG/M
3300025621|Ga0209504_1035359All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1674Open in IMG/M
3300025632|Ga0209194_1095292Not Available761Open in IMG/M
3300025632|Ga0209194_1163600Not Available516Open in IMG/M
3300025645|Ga0208643_1167352Not Available543Open in IMG/M
3300025652|Ga0208134_1045019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1439Open in IMG/M
3300025652|Ga0208134_1129020Not Available662Open in IMG/M
3300025759|Ga0208899_1089006All Organisms → Viruses → Predicted Viral1182Open in IMG/M
3300025769|Ga0208767_1035927All Organisms → Viruses → Predicted Viral2485Open in IMG/M
3300025806|Ga0208545_1081251Not Available884Open in IMG/M
3300025860|Ga0209119_1118174Not Available1143Open in IMG/M
3300025889|Ga0208644_1359949Not Available551Open in IMG/M
3300026437|Ga0247577_1061243Not Available816Open in IMG/M
3300026460|Ga0247604_1036405Not Available1190Open in IMG/M
3300026505|Ga0228647_1056656Not Available979Open in IMG/M
3300027159|Ga0208020_1051769Not Available765Open in IMG/M
3300027320|Ga0208923_1051049Not Available735Open in IMG/M
3300028127|Ga0233401_1012320All Organisms → Viruses → Predicted Viral2310Open in IMG/M
3300028134|Ga0256411_1010969All Organisms → Viruses → Predicted Viral2513Open in IMG/M
3300028396|Ga0228643_1074901Not Available813Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.92%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater16.35%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.58%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine8.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.69%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine5.77%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater5.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.92%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.96%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.96%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.96%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.96%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023702Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024180Seawater microbial communities from Monterey Bay, California, United States - 82DEnvironmentalOpen in IMG/M
3300024267Seawater microbial communities from Monterey Bay, California, United States - 28DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025590Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025860Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1001960563300000115MarineMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGVNHTGRSYGQF*
DelMOSum2011_1003079613300000115MarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMI
DelMOSum2011_1006677423300000115MarineMAIASGFIQTLRRYGARSAKNKTRLEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF*
DelMOSum2011_1015857113300000115MarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIDLNITSTGRSYGQF*
DelMOSum2011_1018711223300000115MarineMLSLLMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII*
DelMOSum2011_1021616913300000115MarineMPSLLMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII*
JGI26273J51734_1000219543300003620MarineMAIASGFIGTLRRYGSRSSSNKKKLEKWLDAAIEEIADNNGGHLVGASANGASFSQIATMTNAEWASALDKALHMIECGVKTTSKSWGQIL*
Ga0070743_1006962823300005941EstuarineMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGINHTGRSYGQF*
Ga0070742_1001882423300005942EstuarineMAIAANFINTLRRYGLRSDANKERLELWLDEAMIEIAQNKGGDVVSGSANGASFSQMANMTVAEWATCLDKALQMIDEGTNFVGRSYGQF*
Ga0075466_112431023300006029AqueousMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII*
Ga0075466_115455723300006029AqueousMAIPAGLINTLRRYGLRSDANKARLELWLDEAIEAIAENKGGHVVSASANGASFSQQANMTNAEWASCLDRALHMIEDGITSTGRSYGRIF*
Ga0070744_1007781423300006484EstuarineMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKALHMIDEGITSTGRSYGQIL*
Ga0098048_105093423300006752MarineMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIENNITSLGRSYGQF*
Ga0098054_114113923300006789MarineGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIENNVTSLGRSFGRT*
Ga0098054_135056113300006789MarineRYGARSDANKAQLETWLDEAIEEIAMNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIEQNVTSLGRSYGQF*
Ga0098055_102549023300006793MarineMAIATGLINTLRRYGASSDANKAQLETWFHEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWMTALDRAIYMIDNNVTSLGRSFGRT*
Ga0098055_131473813300006793MarineMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALYMIENNVTSIGRSYGQF*
Ga0070749_1006342513300006802AqueousMAIAAGFIQTLRRYGARSDANKARLEMWLDEAIEEIAENKGEHIVSGSANGASFSQLANMTNAEWASVLDRALHMIELNIKSTGRSFGQIQ*
Ga0070749_1021489023300006802AqueousMAIAAGFIQTLRRYGARSDANKARLEMWLDEAIEEIADNKGGHIVSGSANGASFSQLANMTNAEWASVLDRALH
Ga0070749_1025002223300006802AqueousMAIANGFIQTLRRYGARSDKNKLQLETWLDEAIEEVAANNGGHIVSGSANGSSFSQLAYMTNAEWAACLDQALYMIDSGIKNISRSYGQF*
Ga0075467_1021295523300006803AqueousMAIPAGIINTLRRYGLRSAANKAKLEMWLDEAIEEIAENRGGHVVSASANGASFSQLANMTNAEWASCLDRALEMIELGINGSGGRSYGNII*
Ga0075467_1040002623300006803AqueousMAIAAGLINTLRRYGARSDANKAKLELWLDEAIESIAENGGGMVLSASANGASFYRQANMSNAEWASALDAALHMIEQGVTGTGRSYGRIF*
Ga0075467_1047647323300006803AqueousMAIEAGLINTLRRYGARSDANKAKLELWLDEAIESIAENKGGSVSSASANGASFSMRPDGMTNAEWMNCLDRALHMIDEGIKSTGRSHGIII*
Ga0075467_1062903223300006803AqueousMASTAKTTNTLRRYGLRSEKNKENLELWLNEVTEEMANNKGGQTVSASANGASFYQVPGMTSEEWMNCLDTALVMIEKGITSTGRSYGQII*
Ga0070754_1013963423300006810AqueousMAIAAGFIQTLRRYGTRSDANKARLEMWLDEAIEEIAENKGGHVVSGSANGASFSQLANMTNAEWASALDAALLMIEQGVKTIGRSYGDV*
Ga0070750_1000852973300006916AqueousMAIAAGFIQTLRRYGARSDANKARLEMWLDEAIEEIADNKGGHIVSGSANGASFSQLANMTNAEWASVLDTALHMIELNIKSTGRSFGQIQ*
Ga0070746_1025880623300006919AqueousMAIANGFIQRLRRYGARSDKNKLQLETWLDEAIEEVAANNGGHIVSGSANGSSFSQLAYMTNAEWAACLDQALYMIDSGIKNISRSYGQF*
Ga0070748_132604713300006920AqueousMAIPAGIINTLRRYGLRSAANKAKLEMWLDEAIEEIAENRGGHVVSASANGASFSQLANMTNGEWASCLDRALEMIENGITGGGRSYGRIY*
Ga0098051_119199913300006924MarineTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALYMIENNVTSLGRSYGQF*
Ga0075468_1013461323300007229AqueousQTLRRYGARSAKNKTRLEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF*
Ga0070747_123944523300007276AqueousLKSPPLLMAIPAGIINTLRRYGLRSAANKAKLEMWLDEAIEEIAENRGGHVVSASANGASFSQLANMTNAEWASCLDRALEMIENGITGGGRSYGRIY*
Ga0070752_113046013300007345AqueousGFIQTLRRYGTRSDANKARLEMWLDEAIEEIAENKGGHVVSGSANGASFSQLANMTNAEWASALDAALLMIEQGVKTIGRSYGDV*
Ga0099847_119864823300007540AqueousMAIASGFIQTLRRYGARSAKNKTRLETWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF*
Ga0102818_106104723300007552EstuarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIELNITSTGRSYGQF*
Ga0102825_104349313300007655EstuarineMPSLLMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKALHMIDEGITST
Ga0102824_113042013300007681EstuarineRSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGINHTGRSYGQF*
Ga0102823_114678623300007692EstuarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIDLNITITG
Ga0102904_110929913300007981EstuarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIDLNI
Ga0102816_103335323300008999EstuarineMPSLLMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKALHMIDEGITSTGRSYGQIL*
Ga0102813_107027723300009003EstuarineMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIELNITSTGRSYG
Ga0115549_102376623300009074Pelagic MarineMAIASDLIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF*
Ga0102815_1055080523300009080EstuarineMAIANGFIGTLRRYGARSAKNKKQLEMWLDEAIEEVAGNHGGHIVSGSANGSSFSQLAYMTNAEWASCLDKALQMIDEGVNYTGRSYGQF*
Ga0114918_1014990723300009149Deep SubsurfaceMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF*
Ga0115548_115544023300009423Pelagic MarineMTVIVMAIANGFISTLRRYGARSAKNKTQLELWLDEAIEEVAGNHGGHIVSGSANGSSFSQLAYMTNAEWASCLDRALHMIDEGVSYTGRSYGQF*
Ga0115570_1048289013300009496Pelagic MarineMLSLLMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGNII*
Ga0115102_1005981823300009606MarineMAIASGFIGTLRRYGSRSSSNKKKLEKWLDAAIEEIADNNRGHLVGASANGASFSQIATMTNAEWASALDKALHMIECGVKTTSKSWGQIL*
Ga0118733_10778231713300010430Marine SedimentTVYIYKMACSAAFIQTLRRYGERSAENKANLEQWLDEAIQSIADGKGGHVSSASANGASFSQTVNMTNAEWAACLDQALLLIESGVKSTGRSYGNFN*
Ga0180120_1012283223300017697Freshwater To Marine Saline GradientMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADSKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII
Ga0180120_1040905513300017697Freshwater To Marine Saline GradientIMAIASGFIQTLRRYGARSTKNKTRLEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0181400_103697623300017752SeawaterMAIANGFIGTLRRYGARSAKNKKQLEMWLDEAIEEVAGNHGGHIVSGSANGSSFSQLAYMTNAEWASCLDKALQMIDDGVNYTGRSYGQF
Ga0181577_1058335523300017951Salt MarshMAIAAGFIGTLRRYGARSDANKARLEMWLDEAIEEIAENKGGHIVSGSANGASFSQLANMTNAEWASALDAALLMIEQGVKTIGRSYGDV
Ga0181553_1035753823300018416Salt MarshMAIPAGIINTLRRYGLRSAANKAKLEMWLDEAIEEIAENRGGHVVSASANGASFSQLANMTNAEWASCLDRALEMIENGITGGGRSYGRIY
Ga0206128_1001907193300020166SeawaterMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGVNHTGRSYGQF
Ga0206128_123588013300020166SeawaterMAIASDLIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0206129_1001717243300020182SeawaterLKSSSFIMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIEMNVTSTGRSYGQF
Ga0206131_1032855223300020185SeawaterLKSPLFIMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIEMNVTSTGRSYGQF
Ga0206130_1009873223300020187SeawaterMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSIVNMTNAEWASCLDRALQMIDEGVKYTGRSYGQF
Ga0206123_1011243023300021365SeawaterMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0213861_1056477123300021378SeawaterMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII
Ga0222717_1005095533300021957Estuarine WaterMAIASGFIGTLRRYGSRSSSNKKKLEKWLDAAIEEIADNNGGHLVGASANGASFSQIATMTNAEWASALDKALHMIECGVKTTSKSWGQIL
Ga0212023_100915233300022061AqueousMAIPAGLINTLRRYGLRSDANKARLELWLDEAIEAIAENKGGHVVSASANGASFSQQANMTNAEWASCLDRALHMIEDGITSTGRSYGRIF
Ga0212023_103686623300022061AqueousMAIPVNFIKTLRVYGETSDVNKAKLSLALDDAMEDLISNKGGSVSSASANGASFSMRPDGMTNAEWMSCLSTAIDMINKGVKSTGRSYGRIF
Ga0196887_103712633300022178AqueousMAIPAGIINTLRRYGLRSAANKAKLEMWLDEAIEEIAENRGGHVVSASANGASFSQLANMTNAEWASCLDRALEMIELGINGSGGRSYGNII
Ga0224498_1023886423300022202SedimentMAIAANFINTLRRYGARSDANKAQLELWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRAIYMIDLNITSTGRSYGQF
(restricted) Ga0233410_1000823743300023276SeawaterMAIASGFIGTLRRYGSRSSSNKKKLEKWLDAAIEEIADNKGGHLVGASANGASFSQIATMTNAEWASALDKALHMIECGVKTTSKSWGQIL
Ga0228694_13489413300023567SeawaterSRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0228696_103962913300023568SeawaterMAASSRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0232112_100013213300023693SeawaterNGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIENNITSLGRSYGQF
Ga0228683_102954013300023694SeawaterRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0232119_100032093300023702SeawaterANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIENNITSLGRSYGQF
Ga0228668_100037123300024180SeawaterMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALHMIENNITSLGRSYGQF
Ga0228623_107130113300024267SeawaterRSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGVNHTGRSYGQF
Ga0228652_102086813300024326SeawaterIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0228672_105179713300024335SeawaterMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMID
Ga0244777_1045351423300024343EstuarineMAIAANFINTLRRYGLRSDANKERLELWLDEAMIEIAQNKGGDVVSGSANGASFSQMANMTVAEWATCLDKALQMIDEGTNFVGRSYGQF
Ga0244775_1007464723300024346EstuarineMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGINHTGRSYGQF
Ga0244775_1059727623300024346EstuarineMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKALHMIDEGITSTGRSYG
Ga0244775_1124968723300024346EstuarineMASEVRLINTLRRYGLRSDKNKANLVMWLDQTIDEIADNKGGHVVSASANGASFYQVANMTNSEWASCLDRAIHMIDEGITSTGRSYGQIL
Ga0228662_103678213300024415SeawaterMAIANGFIGTLRRYGARSAKNKKQLEAWLDEAIEEVASNHGGHIVSGSANGSSFSQLAYMTNAEWASCLDAALLQIESGVKSIGRSYGQF
Ga0208298_100689013300025084MarineMAIATGLINTLRRYGASSDANKAQLETWFHEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWMTALDRAIYMIDNNVTSLGRSFGRT
Ga0208793_101525523300025108MarineLKCWPFIMAIANGFIGTLRRYGARSDANKAQLETWLDEAIEEIAQNKGGDVVSGSANGASFSQMANMTVAEWASALDRALYMIENNVTSIGRSYGQF
Ga0208303_109853123300025543AqueousMAIASGFIQTLRRYGARSAKNKTRLETWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0209195_109404823300025590Pelagic MarineMTVIVMAIANGFISTLRRYGARSAKNKTQLELWLDEAIEEVAGNHGGHIVSGSANGSSFSQLAYMTNAEWASCLDRALHMIDEGVSYTGRSYGQF
Ga0209094_100602323300025594Pelagic MarineLLMAIASDLIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0209094_111576913300025594Pelagic MarineMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYG
Ga0209504_103535923300025621Pelagic MarineLLMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0209194_109529213300025632Pelagic MarineMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDE
Ga0209194_116360023300025632Pelagic MarineSGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0208643_116735213300025645AqueousMAIASGFIQTLRRYGARSAKNKTRLEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0208134_104501923300025652AqueousMAIEAGLINTLRRYGARSDANKAKLELWLDEAIESIAENKGGSVSSASANGASFSMRPDGMTNAEWMNCLDRALHMIDEGIKSTGRSHGIII
Ga0208134_112902013300025652AqueousLFIMAIASGFIQTLRRYGARSAKNKTRLEAWLDDAIEEIAANKGSDVVSGSANGASFSQMANMTVAEWASCLDKALQMIDEGVNYTGRSYGQF
Ga0208899_108900613300025759AqueousMAIAAGFIQTLRRYGTRSDANKARLEMWLDEAIEEIAENKGGHVVSGSANGASFSQLANMTNAEWASALDAALLMIEQGVKTIGRSYGDV
Ga0208767_103592713300025769AqueousMAIAAGFIQTLRRYGARSDANKARLEMWLDEAIEEIAENKGGHIVSGSANGASFSQLANMTNAEWASVLDRALHMIELNIKSTGRSFGQIQ
Ga0208545_108125123300025806AqueousMAISAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII
Ga0209119_111817413300025860Pelagic MarineLMAIAAGFIGTLRRYGLRSAKNKANLELWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDRAIQMIDEGITTTGRSYGQII
Ga0208644_135994913300025889AqueousMAIANGFIQTLRRYGARSDKNKLQLETWLDEAIEEVAANNGGHIVSGSANGSSFSQLAYMTNAEWAACLDQALYMIDSGIKNISRSYGQF
Ga0247577_106124313300026437SeawaterRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGVNHTGRSYGQF
Ga0247604_103640533300026460SeawaterRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0228647_105665623300026505SeawaterMAASSRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSF
Ga0208020_105176923300027159EstuarineMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKAL
Ga0208923_105104923300027320EstuarineMPSLLMAIAAGFIGTLRRYGLRSAKNKANLESWLDEAIEEIADNKGGHTVSASANGASFYQVANMTNAEWASCLDKALHMIDEGITSTGRSYGQIL
Ga0233401_101232023300028127SeawaterMAIASGFIQTLRRYGARSAKNKARMEAWLDDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYTGKSFGQF
Ga0256411_101096913300028134SeawaterTLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNAEWASCLDRALQMIDEGVNHTGRSYGQF
Ga0228643_107490113300028396SeawaterMAASSRFIQSLRRYGARSAKNKARMEAWLEDAIEEIAANKGSDVVSGSANGASFSSMANMTNSEWFSCLDEALQMIDKGVNYT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.