NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097442

Metagenome Family F097442

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097442
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence DFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE
Number of Associated Samples 99
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 97.12 %
% of genes from short scaffolds (< 2000 bps) 98.08 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.308 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.231 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.67%    β-sheet: 8.89%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13485Peptidase_MA_2 17.31
PF07676PD40 2.88
PF00072Response_reg 0.96
PF03450CO_deh_flav_C 0.96
PF07687M20_dimer 0.96
PF02481DNA_processg_A 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 1.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_101692280All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300001537|A2065W1_11692526All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300001566|A2135W6_1102529All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300001991|JGI24743J22301_10079270All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300003319|soilL2_10014812All Organisms → cellular organisms → Bacteria9554Open in IMG/M
3300003366|JGI25321J50212_10128810All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300004156|Ga0062589_101936920All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum596Open in IMG/M
3300004157|Ga0062590_102168318All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005184|Ga0066671_10129088All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1445Open in IMG/M
3300005184|Ga0066671_10442395All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum834Open in IMG/M
3300005184|Ga0066671_10862420All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum576Open in IMG/M
3300005186|Ga0066676_10762295All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005340|Ga0070689_100274510All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300005345|Ga0070692_10837367All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum631Open in IMG/M
3300005356|Ga0070674_100407929All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300005450|Ga0066682_10637240All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum664Open in IMG/M
3300005456|Ga0070678_100805444All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum853Open in IMG/M
3300005471|Ga0070698_100349969All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005518|Ga0070699_101462006All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum627Open in IMG/M
3300005536|Ga0070697_100373220All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1234Open in IMG/M
3300005537|Ga0070730_10739452All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum622Open in IMG/M
3300005546|Ga0070696_101193099All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005549|Ga0070704_100491779All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1063Open in IMG/M
3300005549|Ga0070704_101327005All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005552|Ga0066701_10237891All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1125Open in IMG/M
3300005554|Ga0066661_10861333All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum530Open in IMG/M
3300005556|Ga0066707_10678630All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum648Open in IMG/M
3300005559|Ga0066700_10326561All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1083Open in IMG/M
3300005561|Ga0066699_10298220All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1147Open in IMG/M
3300005568|Ga0066703_10435188All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum787Open in IMG/M
3300005568|Ga0066703_10861096All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum517Open in IMG/M
3300005577|Ga0068857_101871163All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum588Open in IMG/M
3300005587|Ga0066654_10174780All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1104Open in IMG/M
3300005618|Ga0068864_101345687All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300005840|Ga0068870_10303178All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1009Open in IMG/M
3300005903|Ga0075279_10114479All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006028|Ga0070717_10702286All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum919Open in IMG/M
3300006034|Ga0066656_10255777All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1126Open in IMG/M
3300006358|Ga0068871_100303936All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1401Open in IMG/M
3300006800|Ga0066660_10798353All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum769Open in IMG/M
3300006871|Ga0075434_102012269All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum583Open in IMG/M
3300006914|Ga0075436_100690147All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum756Open in IMG/M
3300006954|Ga0079219_11300533All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum640Open in IMG/M
3300007004|Ga0079218_10543816All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300009089|Ga0099828_11634768All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009098|Ga0105245_13296177All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009137|Ga0066709_101528139All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300009147|Ga0114129_11637948All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300009162|Ga0075423_12443925All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300009609|Ga0105347_1436615All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010039|Ga0126309_10823108All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010322|Ga0134084_10435045All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010335|Ga0134063_10483848All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010399|Ga0134127_12901109All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010400|Ga0134122_12021935All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300010401|Ga0134121_10577574All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300011440|Ga0137433_1138652All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012004|Ga0120134_1077185All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012206|Ga0137380_10849712All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012207|Ga0137381_10772485All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012208|Ga0137376_11741713All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012353|Ga0137367_10779525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300012930|Ga0137407_11247742All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300012975|Ga0134110_10138401All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300013297|Ga0157378_13187310All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300014052|Ga0120109_1030768All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300014745|Ga0157377_11239646All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300014823|Ga0120170_1022637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1726Open in IMG/M
3300014969|Ga0157376_12461901All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300015242|Ga0137412_11215724All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300015359|Ga0134085_10146094All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1002Open in IMG/M
3300015359|Ga0134085_10488680All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300015373|Ga0132257_103633524All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300017936|Ga0187821_10047175All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300018433|Ga0066667_12299006All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300018466|Ga0190268_10829402All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018469|Ga0190270_10717028All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300018906|Ga0193609_1077887All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300018920|Ga0190273_10340404All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300019877|Ga0193722_1134527All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300020140|Ga0179590_1086122All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300021363|Ga0193699_10415675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300021377|Ga0213874_10106423All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300022226|Ga0224512_10313409All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300024245|Ga0247677_1016721All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300025324|Ga0209640_10613257All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300025910|Ga0207684_10592253All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300025923|Ga0207681_11485359All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300025927|Ga0207687_11490570All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300025937|Ga0207669_10435637All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300025938|Ga0207704_10052834All Organisms → cellular organisms → Bacteria2465Open in IMG/M
3300025941|Ga0207711_12038921All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300025942|Ga0207689_11487966All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300026095|Ga0207676_11354979All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300026121|Ga0207683_11349480All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300026530|Ga0209807_1160197All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300026552|Ga0209577_10140802All Organisms → cellular organisms → Bacteria1908Open in IMG/M
3300028536|Ga0137415_10615893All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300031731|Ga0307405_10758418All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300031965|Ga0326597_11255523All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300032002|Ga0307416_102580112All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300034143|Ga0334961_034140All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300034268|Ga0372943_0930706All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300034384|Ga0372946_0225099All Organisms → cellular organisms → Bacteria906Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.81%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.96%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001566Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illuminaEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003366Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018906Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 3 min after wetting v1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300022226Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300034143Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNSEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10169228013300000956SoilMVLEENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGSRYVFTN*
A2065W1_1169252613300001537PermafrostRNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTD*
A2135W6_110252923300001566PermafrostNYDELLGMFENLRSLESQLLGIFVSQETSATRYVFTK*
JGI24743J22301_1007927023300001991Corn, Switchgrass And Miscanthus RhizosphereFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVPQETSATRYVFTE*
soilL2_1001481243300003319Sugarcane Root And Bulk SoilFDQRNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTD*
JGI25321J50212_1012881013300003366Deep SubsurfaceFKEFDQRNYDEILGLFENLRALESQIVGIFVAQEMSGTRYVFTD*
Ga0062589_10193692013300004156SoilVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0062590_10216831823300004157SoilENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTN*
Ga0066671_1012908823300005184SoilFKEFDQRNYDELLVLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0066671_1044239513300005184SoilNFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVPQETSATRYVFAN*
Ga0066671_1086242023300005184SoilLEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0066676_1076229513300005186SoilNFRDFKEFDQRNYDEILGLFENLRSLESQLVGIFVSQETSATRYVFTE*
Ga0070689_10027451013300005340Switchgrass RhizosphereENFRDFKEFDQRNYDELLGLFENLRSMETQLVGIFVSQETQASRYVFTQ*
Ga0070692_1083736713300005345Corn, Switchgrass And Miscanthus RhizosphereFDQRNYDELLGLFENLRSLEIQLVGIFVPQETSASRYIFTE*
Ga0070674_10040792923300005356Miscanthus RhizosphereDFKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSATRYVFTE*
Ga0066682_1063724013300005450SoilRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0070678_10080544423300005456Miscanthus RhizosphereEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0070698_10034996923300005471Corn, Switchgrass And Miscanthus RhizosphereQRNYDEILGLFENLRALESQLVGIFVSSETTAARYVFTE*
Ga0070699_10146200613300005518Corn, Switchgrass And Miscanthus RhizosphereFKEFDQRNYDEILGLFENLRALEQQLVGIFVSQETSATRYVFTD*
Ga0070697_10037322013300005536Corn, Switchgrass And Miscanthus RhizosphereEKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0070730_1073945223300005537Surface SoilFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQEMSATRYVFTE*
Ga0070696_10119309923300005546Corn, Switchgrass And Miscanthus RhizosphereNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVSQETSAARYVFTE*
Ga0070704_10049177923300005549Corn, Switchgrass And Miscanthus RhizosphereFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0070704_10132700523300005549Corn, Switchgrass And Miscanthus RhizosphereEENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTN*
Ga0066701_1023789113300005552SoilEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0066661_1086133323300005554SoilDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE*
Ga0066707_1067863023300005556SoilENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0066700_1032656113300005559SoilNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0066699_1029822013300005561SoilDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0066703_1043518813300005568SoilRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE*
Ga0066703_1086109613300005568SoilFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0068857_10187116313300005577Corn RhizosphereNFRDFKEFDQRNYDEILGLFENLRAMETQLVGLFVPQETSATRYVFTE*
Ga0066654_1017478023300005587SoilFDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE*
Ga0068864_10134568723300005618Switchgrass RhizosphereRDFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAARYVFTE*
Ga0068870_1030317823300005840Miscanthus RhizosphereKEFDQRNYDEILGLFENLRAMETQLVGIFVPQETSATRYVFTE*
Ga0075279_1011447923300005903Rice Paddy SoilFRDFKEFDQRDYDEILGLFENLRSLETQLLGIFVSQKTTATRYLFTE*
Ga0070717_1070228613300006028Corn, Switchgrass And Miscanthus RhizosphereFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0066656_1025577723300006034SoilGEKVIEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE*
Ga0068871_10030393613300006358Miscanthus RhizosphereFKEFDQRNYDEILGLFENLRSLESQLVGIFVPQETTASRYVFTE*
Ga0066660_1079835313300006800SoilKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE*
Ga0075434_10201226913300006871Populus RhizosphereEKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0075436_10069014713300006914Populus RhizosphereDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYVFTE*
Ga0079219_1130053313300006954Agricultural SoilDFKEFDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE*
Ga0079218_1054381613300007004Agricultural SoilDEILGLFENLRALESQLVGIFVAQETSGSRYVFTN*
Ga0099828_1163476813300009089Vadose Zone SoilDELLGLFENLRSLETQLIGIFVPQETSASRYIFTE*
Ga0105245_1329617713300009098Miscanthus RhizosphereTGEKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0066709_10152813913300009137Grasslands SoilEKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE*
Ga0114129_1163794813300009147Populus RhizosphereDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE*
Ga0075423_1244392513300009162Populus RhizosphereLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE*
Ga0105347_143661523300009609SoilEENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTD*
Ga0126309_1082310823300010039Serpentine SoilQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE*
Ga0134084_1043504513300010322Grasslands SoilDQRNYDEILGLFENLRAMETQLVGIFVPQETSATRYVFTE*
Ga0134063_1048384813300010335Grasslands SoilQRQYDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE*
Ga0134127_1290110913300010399Terrestrial SoilLEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE*
Ga0134122_1202193523300010400Terrestrial SoilDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0134121_1057757433300010401Terrestrial SoilRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0137433_113865223300011440SoilFKEFDQRNYDEILGLFENLRALEQQLVGIFVAQETSATRYVFTD*
Ga0120134_107718523300012004PermafrostGEKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0137380_1084971213300012206Vadose Zone SoilVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0137381_1077248523300012207Vadose Zone SoilLEDNFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVPQETSAARYVFTE*
Ga0137376_1174171323300012208Vadose Zone SoilDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE*
Ga0137367_1077952513300012353Vadose Zone SoilEILGLFENLRSLEQQLVGIFVSQETSATRYVFTD*
Ga0137407_1124774213300012930Vadose Zone SoilEFDQRNYDEILGLFENLRSLETQLVGIFVSQESSAMRYVFTES*
Ga0134110_1013840123300012975Grasslands SoilYDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE*
Ga0157378_1318731023300013297Miscanthus RhizosphereFRDFKEFDQRNYDEILGLFENLRSLEAQLVGIFVSQETSASRYVFTE*
Ga0120109_103076813300014052PermafrostKVLEDNFRDFKAFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE*
Ga0157377_1123964613300014745Miscanthus RhizosphereDFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAQRYMFTE*
Ga0120170_102263713300014823PermafrostDKVLEENFRDFKEFDQRNYDEILGLFENLRSLEAQLLGIFVSQETSASRYVFTE*
Ga0157376_1246190123300014969Miscanthus RhizosphereDQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE*
Ga0137412_1121572423300015242Vadose Zone SoilGEKVLEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE*
Ga0134085_1014609423300015359Grasslands SoilVEENFRDFKEFDQRNYDEILGLFENLRSLEQQLVGIFVSQETSVTRYVFTD*
Ga0134085_1048868013300015359Grasslands SoilENFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTE*
Ga0132257_10363352423300015373Arabidopsis RhizosphereFDQRQYDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE*
Ga0187821_1004717513300017936Freshwater SedimentKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE
Ga0066667_1229900623300018433Grasslands SoilDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE
Ga0190268_1082940213300018466SoilGEMILEENFRDFKEFDQRNYDEILGLFENLRALEAQLVGIFVAQETSGTRYVFTE
Ga0190270_1071702813300018469SoilRNYDEILGLFENLRSLETQLVGIFVSQETSAARYVFTE
Ga0193609_107788723300018906SoilVEENFRDFKEFDQRHYDEILGLFENLRALESQLVGIFVSQETSASRYVFSR
Ga0190273_1034040413300018920SoilNFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGSRYVFTN
Ga0193722_113452723300019877SoilNEVLGLFENLRSMETQLVGIFVPQETSATRYVFTE
Ga0179590_108612213300020140Vadose Zone SoilDTGEKVLEENFRDFKEFDQRNYDEILGLFENLRSLEAQLVGIFVSQETSASRYVFTE
Ga0193699_1041567523300021363SoilRNYDEILGLFENLRALESQLIGIFVAQETSGSRYVFTN
Ga0213874_1010642323300021377Plant RootsDSGEKVLEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE
Ga0224512_1031340913300022226SedimentRDFKEYAQRDYDEILGLFENLRSLESQILSIFVAQERSATRFLFVP
Ga0247677_101672123300024245SoilKVLEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE
Ga0209640_1061325713300025324SoilDNFRDFKEFDQRNYDEILGLFENLRSLETQLLGIFVSQETSATRFVFRH
Ga0207684_1059225323300025910Corn, Switchgrass And Miscanthus RhizosphereKVLEENFRDFKEFDQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE
Ga0207681_1148535923300025923Switchgrass RhizosphereFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE
Ga0207687_1149057013300025927Miscanthus RhizosphereTGEKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE
Ga0207669_1043563713300025937Miscanthus RhizosphereRDVKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSATRYVFTE
Ga0207704_1005283423300025938Miscanthus RhizosphereLEENFRDFKEFDQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE
Ga0207711_1203892123300025941Switchgrass RhizosphereNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE
Ga0207689_1148796623300025942Miscanthus RhizosphereDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE
Ga0207676_1135497913300026095Switchgrass RhizosphereRDFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAARYVFTE
Ga0207683_1134948023300026121Miscanthus RhizosphereENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE
Ga0209807_116019733300026530SoilYDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE
Ga0209577_1014080213300026552SoilLEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE
Ga0137415_1061589323300028536Vadose Zone SoilVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTQ
Ga0307405_1075841813300031731RhizosphereEENFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVSRETSATRYVFTD
Ga0326597_1125552323300031965SoilVEENFRDFKEFDQRNYDEILGLFENLRSLESQLVGIFVPQETSATRYVFTE
Ga0307416_10258011223300032002RhizosphereTGEKVLEENFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVSRETSATRYVFTD
Ga0334961_034140_741_8723300034143Sub-Biocrust SoilKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTE
Ga0372943_0930706_409_5763300034268SoilGEKVVEENFRDFKEFDQRNYDEILGLFENLRALEAQLVGIFVPQETSASRYVFTD
Ga0372946_0225099_2_1363300034384SoilFKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSGSRYVFTN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.