NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097462

Metagenome Family F097462

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097462
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 49 residues
Representative Sequence IDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Number of Associated Samples 91
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.65 %
% of genes near scaffold ends (potentially truncated) 87.50 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(7.692 % of family members)
Environment Ontology (ENVO) Unclassified
(43.269 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.538 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.85%    β-sheet: 0.00%    Coil/Unstructured: 93.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13620CarboxypepD_reg 33.65
PF03992ABM 4.81
PF13517FG-GAP_3 4.81
PF00069Pkinase 2.88
PF06580His_kinase 1.92
PF13551HTH_29 0.96
PF13414TPR_11 0.96
PF02371Transposase_20 0.96
PF00581Rhodanese 0.96
PF07676PD40 0.96
PF04143Sulf_transp 0.96
PF02602HEM4 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 11.54
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 1.92
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 1.92
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 0.96
COG2391Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domainsGeneral function prediction only [R] 0.96
COG3547TransposaseMobilome: prophages, transposons [X] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0944660Not Available1526Open in IMG/M
3300003994|Ga0055435_10259558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300005093|Ga0062594_100953368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300005295|Ga0065707_10018613All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300005328|Ga0070676_10322552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1054Open in IMG/M
3300005328|Ga0070676_10818109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300005334|Ga0068869_101259143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300005343|Ga0070687_100383083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300005344|Ga0070661_100817642All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300005353|Ga0070669_100038130All Organisms → cellular organisms → Bacteria3488Open in IMG/M
3300005354|Ga0070675_100550042All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300005439|Ga0070711_100244340All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300005466|Ga0070685_10546652All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005471|Ga0070698_100774448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300005543|Ga0070672_100257504All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300005560|Ga0066670_10714359All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005564|Ga0070664_101931670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300005574|Ga0066694_10319152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300005719|Ga0068861_100878959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium847Open in IMG/M
3300005764|Ga0066903_100420625All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300005764|Ga0066903_107553256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300005844|Ga0068862_100005998All Organisms → cellular organisms → Bacteria10117Open in IMG/M
3300006354|Ga0075021_10996969All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006844|Ga0075428_102206814All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006846|Ga0075430_100464757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300006847|Ga0075431_100113431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2798Open in IMG/M
3300006852|Ga0075433_10044232All Organisms → cellular organisms → Bacteria3868Open in IMG/M
3300006853|Ga0075420_101231075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300009098|Ga0105245_11702039All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300009147|Ga0114129_12471286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300009148|Ga0105243_12670531Not Available539Open in IMG/M
3300009157|Ga0105092_10197923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1122Open in IMG/M
3300009174|Ga0105241_12035744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300009174|Ga0105241_12263904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300009177|Ga0105248_13138998All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300010046|Ga0126384_10818253All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300010358|Ga0126370_10271259All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300010361|Ga0126378_11377523All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300010398|Ga0126383_10912407All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300010400|Ga0134122_11130335All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300011416|Ga0137422_1161997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300011439|Ga0137432_1082902All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300011441|Ga0137452_1114042All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300012208|Ga0137376_11571803All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012355|Ga0137369_10750070All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300012469|Ga0150984_101153147All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300012483|Ga0157337_1040347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300012495|Ga0157323_1018094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300012519|Ga0157352_1061218All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium586Open in IMG/M
3300012683|Ga0137398_10459251All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300012897|Ga0157285_10298179Not Available547Open in IMG/M
3300012912|Ga0157306_10178648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300012914|Ga0157297_10179429All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300012958|Ga0164299_11453125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300013306|Ga0163162_11808055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300013308|Ga0157375_12263752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300015077|Ga0173483_10189758All Organisms → cellular organisms → Bacteria → Acidobacteria938Open in IMG/M
3300015201|Ga0173478_10042997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1439Open in IMG/M
3300015371|Ga0132258_10113910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium6410Open in IMG/M
3300015371|Ga0132258_10113988All Organisms → cellular organisms → Bacteria6408Open in IMG/M
3300015371|Ga0132258_13183918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300015373|Ga0132257_102502407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300015374|Ga0132255_100034411All Organisms → cellular organisms → Bacteria6454Open in IMG/M
3300016371|Ga0182034_11191650All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300021082|Ga0210380_10058571All Organisms → cellular organisms → Bacteria1670Open in IMG/M
3300021082|Ga0210380_10203533All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300025160|Ga0209109_10252865All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300025893|Ga0207682_10135528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1102Open in IMG/M
3300025907|Ga0207645_10548877All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300025911|Ga0207654_10817795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300025923|Ga0207681_10348186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1185Open in IMG/M
3300025923|Ga0207681_10810189All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300025926|Ga0207659_11392634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300025927|Ga0207687_11090932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300025930|Ga0207701_10256738All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300025930|Ga0207701_10356147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1265Open in IMG/M
3300025930|Ga0207701_10498339All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300025936|Ga0207670_10095305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2113Open in IMG/M
3300025936|Ga0207670_10652959All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300025938|Ga0207704_10264339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1299Open in IMG/M
3300025938|Ga0207704_10372029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1119Open in IMG/M
3300025942|Ga0207689_11236247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300026023|Ga0207677_11000089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300026023|Ga0207677_11052649All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300026035|Ga0207703_10051508All Organisms → cellular organisms → Bacteria3337Open in IMG/M
3300026035|Ga0207703_10256258All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300026067|Ga0207678_11624321All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300026118|Ga0207675_100888105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium907Open in IMG/M
3300026121|Ga0207683_11186500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300027614|Ga0209970_1112525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300027731|Ga0209592_1082560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1182Open in IMG/M
3300027880|Ga0209481_10281356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300028812|Ga0247825_10656501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300031716|Ga0310813_12172998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300031740|Ga0307468_100269585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1212Open in IMG/M
3300031892|Ga0310893_10552713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300031908|Ga0310900_11059046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300031940|Ga0310901_10146896All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300031943|Ga0310885_10593433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300032003|Ga0310897_10276968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300032076|Ga0306924_12552328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300032211|Ga0310896_10259848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300033433|Ga0326726_10401272All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1301Open in IMG/M
3300033551|Ga0247830_10717872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere6.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_094466012228664021SoilNVNLGHTHANIAVDVLNLANANTPTSYQQNYGDGRQYLQPLTILNPRLXRFNVTVEF
Ga0055435_1025955823300003994Natural And Restored WetlandsKRANFAVDVLNLFNANTGTAFQQNYGDGSQYLWPTAILNPRFVRFNVTVDF*
Ga0062594_10095336823300005093SoilMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF*
Ga0065707_1001861333300005295Switchgrass RhizosphereKLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0070676_1032255223300005328Miscanthus RhizosphereIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0070676_1081810913300005328Miscanthus RhizosphereKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0068869_10125914323300005334Miscanthus RhizosphereDLRVGKLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0070687_10038308313300005343Switchgrass RhizosphereLNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF*
Ga0070661_10081764213300005344Corn RhizosphereADIAVDLVNLFNANTPTSYQQMYGDGTHYLEPLTILNPRFVRLNVTMEF*
Ga0070669_10003813033300005353Switchgrass RhizosphereQVDLRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0070675_10055004223300005354Miscanthus RhizosphereRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0070711_10024434013300005439Corn, Switchgrass And Miscanthus RhizosphereLAIDVLNLFNSNTGTMFQQNYGDGSQFLNPTQILNPRFVRFNVTVDF*
Ga0070685_1054665223300005466Switchgrass RhizosphereGKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF*
Ga0070698_10077444813300005471Corn, Switchgrass And Miscanthus RhizosphereNIALDLLNLFNANTGTAFQQTFGDGSGYLAPTAILNPRFVRCNVTLDF*
Ga0070672_10025750423300005543Miscanthus RhizosphereMRVGKNLTMGGTRVNLAADVLNLSNANTPTSYQQNYGDGRQYLQPLAILNPRLLRLNVTVEF*
Ga0066670_1071435923300005560SoilQVDARIGKILKFGRTNTNVAIDVLNLFNSNTGTAFMQNFDANYLVPTQILNPRFVRFNVTVDF*
Ga0070664_10193167023300005564Corn RhizosphereKNLHIGGARASIAVDVLNVANANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF*
Ga0066694_1031915213300005574SoilLTAGADRHTNIAVDLLNLFNANTGTNFQMNYGDGSGYLTPTAILNPRIVKFNVTVDF*
Ga0068861_10087895923300005719Switchgrass RhizosphereANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF*
Ga0066903_10042062523300005764Tropical Forest SoilILNLFNSNTGTMFQQNYGDGSGYLAPTAILNPRFVRLNVTVDF*
Ga0066903_10755325613300005764Tropical Forest SoilNTGTMFQLNYGDGSQYLNPTQILNPRFVRFNVTVDF*
Ga0068862_10000599813300005844Switchgrass RhizosphereIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0075021_1099696913300006354WatershedsFNANTGTAFQQNYGDGPQYLNPTAILNPRFVRFNVTVDF*
Ga0075428_10220681413300006844Populus RhizosphereAVDLLNLFNANTPTSYQQNYGDGTQYLQPLTILNPRFVRFNVTMDF*
Ga0075430_10046475723300006846Populus RhizosphereVGKIFNIGGTRTNVAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMEF
Ga0075431_10011343123300006847Populus RhizosphereVAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMEF*
Ga0075433_1004423213300006852Populus RhizosphereIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0075420_10123107523300006853Populus RhizosphereVAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFKVTMEF*
Ga0105245_1170203923300009098Miscanthus RhizosphereLFNAHTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF*
Ga0114129_1247128623300009147Populus RhizosphereKILRLGRYRTSLAVDFLNIFNSNTGTMFQQNYGDGTGYLVPLTILNPRLARINVTVDF*
Ga0105243_1267053123300009148Miscanthus RhizosphereLFNANTGTAFQQTFGDGSGYLAPTAILNPRFVRCNVTLDF*
Ga0105092_1019792323300009157Freshwater SedimentLYRIRVGLVLHTNVGIDLLNLFNANTGTAFEQNGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0105241_1203574413300009174Corn RhizosphereIDLLNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF*
Ga0105241_1226390413300009174Corn RhizosphereRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0105248_1313899813300009177Switchgrass RhizosphereLFNSNTGTSFNQTYGDGTSYLRPTAILTPRFVRANVTFTF*
Ga0126384_1081825313300010046Tropical Forest SoilSNTGTAFQQNYGDGSGYLVPTAILNPRFIRFNVTVDF*
Ga0126370_1027125913300010358Tropical Forest SoilVAIDILNLFNSNTGTAFQQNYGDGSGFLAPTAILNPRFVRFNVTVDF*
Ga0126378_1137752323300010361Tropical Forest SoilDRINQVDARFGKILKFGRSSTNVAIDVLNLFNSNTGTAFQQNYGDGTGYLVPTAILNPRFVRLNVTVDF*
Ga0126383_1091240713300010398Tropical Forest SoilLFNSNTGTMFQQNYGDGSGYLAPTAILNPRFVRLNVTVDF*
Ga0134122_1113033523300010400Terrestrial SoilGSRRANIAIDVLNLFNANTGTAFTQMYGDGSTFLNPTAILNPRFVRFNVTVDF*
Ga0137422_116199713300011416SoilNLFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF*
Ga0137432_108290213300011439SoilLFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF*
Ga0137452_111404223300011441SoilDLLNLFNANTPTSYQQTYGDGTQYLQPLSILNPRFARFNVTVDF*
Ga0137376_1157180313300012208Vadose Zone SoilNLFNANTGYQFQQNYGDGSGYLTPTMILTPRFVKFNVTVDF*
Ga0137369_1075007023300012355Vadose Zone SoilGKKRTSIAVDLLNLFNANTGYQFQQNYGDGSGYLTPTMILTPRFIKFNVTVDF*
Ga0150984_10115314723300012469Avena Fatua RhizosphereVNFGTKRANFAVDVLNLFNANTGTNFNQNYDANYLNPTQILNPRFVRFNVTVDF*
Ga0157337_104034713300012483Arabidopsis RhizosphereFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0157323_101809413300012495Arabidopsis RhizosphereNTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0157352_106121823300012519Unplanted SoilFNANTPTSYQQTYGDGTQFLQPLTILNPRLLRFNVTLDF*
Ga0137398_1045925113300012683Vadose Zone SoilLNLGSKRANIAIDVLNLFNSNTGTAFQQTFGTAFLNPTAILNPRFVRFNVTVDF*
Ga0157285_1029817923300012897SoilNANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF*
Ga0157306_1017864813300012912SoilMRFGKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF*
Ga0157297_1017942923300012914SoilGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF*
Ga0164299_1145312523300012958SoilFNANTGTNFNQNYDANYLNPTQILNPRFVRFNMTVDF*
Ga0163162_1180805523300013306Switchgrass RhizosphereMRFGKIVKAGRARANIGVDLLNLLNANTPTSYQQNYGVDGTQYLQPLSILSPRVLRLNVTLDF*
Ga0157375_1226375213300013308Miscanthus RhizosphereTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0173483_1018975813300015077SoilNTPTAYQSNFGDGSGYLAPTAILNPRLARLSVTIDF*
Ga0173478_1004299713300015201SoilDLRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0132258_1011391043300015371Arabidopsis RhizosphereDARFGKILNFGSKRANISIDVLNLFNANTGTAFQQNYGDGSAYLNPTQILNARFVRFNVTVDF*
Ga0132258_1011398883300015371Arabidopsis RhizosphereNANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF*
Ga0132258_1318391823300015371Arabidopsis RhizosphereFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF*
Ga0132257_10250240713300015373Arabidopsis RhizosphereIDVLNLFNSNTGTMFQLNYGDGTQYLNPTQILNPRFVRFNVTVDF*
Ga0132255_10003441113300015374Arabidopsis RhizosphereSKRANIAVDLLNLFNANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF*
Ga0182034_1119165023300016371SoilDARFGKIFNFGKTRANIALDVLNLLNANTGTAFQQNYGDGSQYLNPTSILTPRILRVNVTMDF
Ga0210380_1005857123300021082Groundwater SedimentMGGTRVNLAADILNLANANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF
Ga0210380_1020353323300021082Groundwater SedimentLNLFNANTGTMFQQNYDGSTYLNPTQILNPRFVRFNVTVDF
Ga0209109_1025286523300025160SoilAVDLLNLFNANTPTAYQQNFGDGSQYLQPQTILNPRFVRFNVTVDF
Ga0207682_1013552823300025893Miscanthus RhizosphereMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF
Ga0207645_1054887713300025907Miscanthus RhizosphereNLLNANTGTMFQQNYDGSTYLNPTQILNPRFVRFNVTVDF
Ga0207654_1081779513300025911Corn RhizosphereRVGKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMD
Ga0207681_1034818623300025923Switchgrass RhizosphereILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0207681_1081018923300025923Switchgrass RhizosphereTYVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0207659_1139263413300025926Miscanthus RhizosphereTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0207687_1109093213300025927Miscanthus RhizosphereWYRSSLAVDFLNIFNANTPTAYQSNFGDGSGYLATTAILNPRLARLSVTIDF
Ga0207701_1025673813300025930Corn, Switchgrass And Miscanthus RhizosphereTPTAYQSNFGDGSGYLAPTAILNPRLARLSVTIDF
Ga0207701_1035614733300025930Corn, Switchgrass And Miscanthus RhizosphereDILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF
Ga0207701_1049833913300025930Corn, Switchgrass And Miscanthus RhizosphereGRARANIGVDLLNLLNANTPTSYQQNYGVDGTQYLKPLSILSPRVLRLNVTLDF
Ga0207670_1009530513300025936Switchgrass RhizosphereLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0207670_1065295923300025936Switchgrass RhizosphereVDLRVGKLFNIGGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0207704_1026433913300025938Miscanthus RhizosphereTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF
Ga0207704_1037202913300025938Miscanthus RhizosphereKLFNIGGTRTNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0207689_1123624713300025942Miscanthus RhizosphereNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0207677_1100008913300026023Miscanthus RhizosphereIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0207677_1105264913300026023Miscanthus RhizosphereLFNSNTGTAFQTNYGNGSGYLAPTAILNPRLARFNVTIDF
Ga0207703_1005150813300026035Switchgrass RhizosphereDLVTLINANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF
Ga0207703_1025625823300026035Switchgrass RhizosphereTGTAFQTNYGDGSGYLAPTAILNPRLARINVTVDF
Ga0207678_1162432123300026067Corn RhizosphereVDVLNVGNANTPTSYQQTYGDGTQYLQPLTILNPRFARFNVTVDF
Ga0207675_10088810513300026118Switchgrass RhizosphereIVNLGSKRANIAIDLLNLFNANTATAYQQNYGDGTQYLQPLQVLNPRFVRFNVTVDF
Ga0207683_1118650023300026121Miscanthus RhizosphereAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0209970_111252513300027614Arabidopsis Thaliana RhizosphereVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0209592_108256023300027731Freshwater SedimentGKLLNIGGTRTNIAIDLLNLFNSNTGTAFEQNYGDGSGYLRPTQILNPRFVRFNVTMDF
Ga0209481_1028135613300027880Populus RhizosphereVAIDLLNLFNANTGTAFEQNYGDGSQYLRPTQILNPRFVRFKVTMEF
Ga0247825_1065650123300028812SoilMRFGKNLTMGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF
Ga0310813_1217299813300031716SoilNVAIDLLNLFNANTGTAFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0307468_10026958513300031740Hardwood Forest SoilDLRVGKLLNIGGTRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0310893_1055271323300031892SoilSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0310900_1105904613300031908SoilFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0310901_1014689623300031940SoilVGKLFNIGGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0310885_1059343313300031943SoilRTNVAIDILNLFNSNTGTAFEQNYGDGSQYLRPTQILNPRFVRFNVTMDF
Ga0310897_1027696823300032003SoilGGTRTNVAIDLLNLFNANTGTMFQQNYGDGTQYLQPTQILNPRFVRFNVTMDF
Ga0306924_1255232823300032076SoilRFGKIFNFGKTRANIALDVLNLLNANTGTAFQQNYGDGSQYLNPTSILTPRILRVNVTMD
Ga0310896_1025984813300032211SoilNLFNANTPTSYQQNYGDGTQYLQPLTILNPRFARFNVTLDF
Ga0326726_1040127213300033433Peat SoilNTGTAFQLNYGDGSQYLNPTQILNPRFVRFNVTVDF
Ga0247830_1071787213300033551SoilGGTRVNLAADILNLTNANTPTSYQQNYGDGRQYLQPLAILNPRFVRLNVTVDF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.