Basic Information | |
---|---|
Family ID | F097553 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | IRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIVP |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 96.15 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.077 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.577 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.615 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 21.74% Coil/Unstructured: 65.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF02706 | Wzz | 88.46 |
PF13807 | GNVR | 1.92 |
PF11959 | DUF3473 | 0.96 |
PF01522 | Polysacc_deac_1 | 0.96 |
PF02371 | Transposase_20 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 88.46 |
COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 88.46 |
COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 88.46 |
COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 88.46 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.08 % |
Unclassified | root | N/A | 1.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105888885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1374 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1038121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300000789|JGI1027J11758_12415246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1046 | Open in IMG/M |
3300000955|JGI1027J12803_100255606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 933 | Open in IMG/M |
3300000955|JGI1027J12803_105862145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300002090|JGI24806J26614_1009512 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300002123|C687J26634_10093859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1076 | Open in IMG/M |
3300002243|C687J29039_10056077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1521 | Open in IMG/M |
3300002530|C687J35503_10108981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
3300003994|Ga0055435_10233159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300004156|Ga0062589_102212720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300004479|Ga0062595_100121095 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300004778|Ga0062383_10256281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
3300004801|Ga0058860_11849395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
3300005295|Ga0065707_10347399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
3300005332|Ga0066388_101233390 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300005356|Ga0070674_100079851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
3300005471|Ga0070698_100332176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
3300005536|Ga0070697_100454157 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300005981|Ga0081538_10226161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300006237|Ga0097621_100967236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 795 | Open in IMG/M |
3300006797|Ga0066659_10480363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
3300006845|Ga0075421_102382989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300006852|Ga0075433_11299185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300006852|Ga0075433_11495627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300006894|Ga0079215_11157692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300006904|Ga0075424_100338288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1603 | Open in IMG/M |
3300007004|Ga0079218_11247098 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300007004|Ga0079218_13206950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300007076|Ga0075435_101371861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 619 | Open in IMG/M |
3300009038|Ga0099829_11683548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
3300009090|Ga0099827_11023651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
3300009094|Ga0111539_10386991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1628 | Open in IMG/M |
3300009094|Ga0111539_12046847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
3300009162|Ga0075423_10021906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6353 | Open in IMG/M |
3300009162|Ga0075423_12112780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300009444|Ga0114945_10580748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
3300009545|Ga0105237_11276211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
3300009597|Ga0105259_1073660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300010046|Ga0126384_11045390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300010046|Ga0126384_11109132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
3300010047|Ga0126382_10662551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
3300010400|Ga0134122_12489745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300010401|Ga0134121_11963968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300011271|Ga0137393_11205339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
3300011430|Ga0137423_1166993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
3300012175|Ga0137321_1112541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
3300012361|Ga0137360_11864945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300012901|Ga0157288_10275135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300012948|Ga0126375_10564218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 862 | Open in IMG/M |
3300012951|Ga0164300_10031831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1944 | Open in IMG/M |
3300012958|Ga0164299_10909657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
3300012960|Ga0164301_10249979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1164 | Open in IMG/M |
3300012971|Ga0126369_10235743 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300012985|Ga0164308_10181249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1587 | Open in IMG/M |
3300012988|Ga0164306_11541609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
3300014326|Ga0157380_13289374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300014968|Ga0157379_12061882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
3300015242|Ga0137412_10680923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
3300015373|Ga0132257_100957549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1075 | Open in IMG/M |
3300015374|Ga0132255_100801588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1404 | Open in IMG/M |
3300015374|Ga0132255_101386188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
3300016341|Ga0182035_10673920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
3300017792|Ga0163161_10726247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
3300018028|Ga0184608_10407721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
3300018029|Ga0187787_10057774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1161 | Open in IMG/M |
3300018029|Ga0187787_10432248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300018031|Ga0184634_10106974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1226 | Open in IMG/M |
3300018063|Ga0184637_10030384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3270 | Open in IMG/M |
3300018071|Ga0184618_10216343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 804 | Open in IMG/M |
3300018078|Ga0184612_10521129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300018081|Ga0184625_10443981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
3300018082|Ga0184639_10274515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 889 | Open in IMG/M |
3300018084|Ga0184629_10569690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300018422|Ga0190265_10242343 | Not Available | 1845 | Open in IMG/M |
3300020021|Ga0193726_1363765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300022563|Ga0212128_10723740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
3300025164|Ga0209521_10601211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
3300025165|Ga0209108_10195438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1048 | Open in IMG/M |
3300025167|Ga0209642_10006335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7406 | Open in IMG/M |
3300025290|Ga0207673_1051675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
3300025318|Ga0209519_10109733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1624 | Open in IMG/M |
3300025322|Ga0209641_10710563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
3300025899|Ga0207642_11086112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300025936|Ga0207670_11663844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300025986|Ga0207658_10907069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
3300027513|Ga0208685_1056088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 851 | Open in IMG/M |
3300027843|Ga0209798_10345551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 705 | Open in IMG/M |
3300027843|Ga0209798_10528296 | Not Available | 534 | Open in IMG/M |
3300027846|Ga0209180_10204489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1138 | Open in IMG/M |
3300027862|Ga0209701_10693669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300027907|Ga0207428_11205748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300027910|Ga0209583_10630498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300030619|Ga0268386_11010465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300031716|Ga0310813_10354268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1251 | Open in IMG/M |
3300031753|Ga0307477_10751243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
3300031908|Ga0310900_11199955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
3300031949|Ga0214473_10484103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1384 | Open in IMG/M |
3300032157|Ga0315912_10353734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1160 | Open in IMG/M |
3300032180|Ga0307471_101198559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
3300032180|Ga0307471_101614995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 804 | Open in IMG/M |
3300032892|Ga0335081_10398104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1773 | Open in IMG/M |
3300033557|Ga0316617_101721764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300033814|Ga0364930_0284123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.88% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
3300002530 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1058888852 | 3300000364 | Soil | RDGSKVTEYVVDYDAIIKGDLKQDVLLRPGDRIIVP* |
KanNP_Total_noBrdU_T14TCDRAFT_10381211 | 3300000596 | Soil | TIFADRSNIRVVRREGNRVTEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
JGI1027J11758_124152462 | 3300000789 | Soil | ADRDKIRVVRRAGEKVTEYIVDYDAIIKGDLQQDILLRPGDRVVVR* |
JGI1027J12803_1002556061 | 3300000955 | Soil | GDKITEYVVDYDAILKGDLKQDILLRPGDRIIVP* |
JGI1027J12803_1058621452 | 3300000955 | Soil | TRSGGLGIFADRSNIRIVRREGPKITEYIVDYDAIIKGDLKQDLLLRPGDRIIIP* |
JGI24806J26614_10095122 | 3300002090 | Soil | RAGGLGVFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVQ* |
C687J26634_100938591 | 3300002123 | Soil | TGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP* |
C687J29039_100560771 | 3300002243 | Soil | RAGGPTIFAQRRDIKTVRRTGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP* |
C687J35503_101089812 | 3300002530 | Soil | LQLITRAGGPTIFAQRRDIKTVRRTGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP* |
Ga0055435_102331591 | 3300003994 | Natural And Restored Wetlands | ITRMGGLGIFADRSNIRIVRRDGVKITEYVVDYDAIINGDLKQDLLLRPGDRVIIP* |
Ga0062589_1022127201 | 3300004156 | Soil | RNIRISRRQGEKITEFVVDYDAILEGDLKQDILLKPGDRIVVP* |
Ga0062595_1001210952 | 3300004479 | Soil | FADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0062383_102562812 | 3300004778 | Wetland Sediment | LNGNESLLQLITRAGGLTIFADRRNIKTVRRNGDRVMEFLSDYEAILTGDFKQDIILKPGDRIIVP* |
Ga0058860_118493951 | 3300004801 | Host-Associated | FADRRNIRISRRQGEKITEFVVDYDAILEGDLKQDILLKPGDRIVVP* |
Ga0065707_103473992 | 3300005295 | Switchgrass Rhizosphere | IRVVRREGDKITEYIADYDGIIKGDLKHDILLRPGDRIIVP* |
Ga0066388_1012333902 | 3300005332 | Tropical Forest Soil | IFADRSNIRVVRREGDKVTEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0070674_1000798513 | 3300005356 | Miscanthus Rhizosphere | VVRREGNRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP* |
Ga0070698_1003321761 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GGLTIFAKHDNIRVVRRAGEKVTEYIVDYNAILKGDLEQDILLRPGDRIVVR* |
Ga0070697_1004541572 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GIFDDRKNIRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIVP* |
Ga0081538_102261611 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VVRRDGDKVTEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0097621_1009672362 | 3300006237 | Miscanthus Rhizosphere | MRRSEGKVTEFIVDYDAILKGDLKQDILLRPGDRVLVP* |
Ga0066659_104803631 | 3300006797 | Soil | DGDKVTEYVADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0075421_1023829891 | 3300006845 | Populus Rhizosphere | IRVVRRDGVKITEYVADYDGIIKGDLRQDILLRPGDRIIVP* |
Ga0075433_112991852 | 3300006852 | Populus Rhizosphere | SNIRVVRREGSKVTEYTVDYDAIIKGDLRQDVLLRPGDRIIVP* |
Ga0075433_114956271 | 3300006852 | Populus Rhizosphere | VFDDRRNVRVVRRDGDKITEYVVDYDAILKGDLKQDILLRPGDRIIVP* |
Ga0079215_111576921 | 3300006894 | Agricultural Soil | SVFANRSNIRVVRRDGDRVTEYIVDYDAIINGDLKQDVLLRPGDRIIVP* |
Ga0075424_1003382882 | 3300006904 | Populus Rhizosphere | EGSKVTEYIVDYDAIIKGDLKQDVLLRPGDRIIVP* |
Ga0079218_112470982 | 3300007004 | Agricultural Soil | DGDRVTEYIVDYDAIINGDLKQDVLLRPGDRIIVP* |
Ga0079218_132069502 | 3300007004 | Agricultural Soil | ITRMGGLGIFADRSNIRIVRREGTKITEFIVDYDAIINGDLKQDLLLRPGDRIIIP* |
Ga0075435_1013718612 | 3300007076 | Populus Rhizosphere | GVFADRSNIRVVRREGSKVTEYTVDYDAIIKGDLRQDVLLRPGDRIIVP* |
Ga0099829_116835481 | 3300009038 | Vadose Zone Soil | NRDKIRVVRRAGEKVTEYIVDYDAILKGDLKQDILLRPGDRIIVQ* |
Ga0099827_110236511 | 3300009090 | Vadose Zone Soil | LTAFADRDKIRVVRRAEEQVTEYIVDYDAILKGDLKQDILLRPGDRVIVR* |
Ga0111539_103869911 | 3300009094 | Populus Rhizosphere | GIFADRSNIRVVRREGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP* |
Ga0111539_120468472 | 3300009094 | Populus Rhizosphere | QGDKVTEFVVDYDAILKGDLKQDILLKPGDRIVVP* |
Ga0075423_100219061 | 3300009162 | Populus Rhizosphere | REGPKITEYIVDYDAIIKGDLKQDLLLRPGDRIIIP* |
Ga0075423_121127802 | 3300009162 | Populus Rhizosphere | MHNADQRKVIELVVDYDAILKGDLKQDILLRPGDRILVP* |
Ga0114945_105807482 | 3300009444 | Thermal Springs | ASRSNIRVVRREGEKVKEFTVDYDAIVAGDLKQDIPLKPGDRVIVP* |
Ga0105237_112762111 | 3300009545 | Corn Rhizosphere | LLTRAGGLGIFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0105259_10736602 | 3300009597 | Soil | VFADRSNIRVLRRDGVKITEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0126384_110453901 | 3300010046 | Tropical Forest Soil | EGKVTEFIVDYDAIVKGDLKQDVILRPGDRIIVP* |
Ga0126384_111091321 | 3300010046 | Tropical Forest Soil | GVNVTEYVVDYEAISKGDLKQDIVLRPGDRIIVE* |
Ga0126382_106625512 | 3300010047 | Tropical Forest Soil | FADRSNIRVVRREGDKVTEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0134122_124897452 | 3300010400 | Terrestrial Soil | GIFADRSNVRVVRRDGDRITEYIVDYDAILKGDLRQDILLRPGDRIIVP* |
Ga0134121_119639681 | 3300010401 | Terrestrial Soil | LLQLLTRAGGLGVFAARSNIRVVPRDGSRVTDYTVDYDAIIKGDLKQDVLLRPGDRVIVR |
Ga0137393_112053391 | 3300011271 | Vadose Zone Soil | IRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIVP* |
Ga0137423_11669932 | 3300011430 | Soil | RDAIKVMRRDGIKLIEYIVDYDAILAGDLRQDIVLRPGDRIIVP* |
Ga0137321_11125412 | 3300012175 | Soil | SVFADRSNIRVLRRDGVKITEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0137360_118649452 | 3300012361 | Vadose Zone Soil | KNIRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIVP* |
Ga0157288_102751352 | 3300012901 | Soil | GIRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP* |
Ga0126375_105642181 | 3300012948 | Tropical Forest Soil | SVFADRSNIRIVRRDGEKITEYIADYDAIIKGDLKQDILLRPGDRIIVP* |
Ga0164300_100318311 | 3300012951 | Soil | RAGGLGIFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0164299_109096572 | 3300012958 | Soil | RISRRQGEKITEFVVDYDAILEGDLKQDILLKPGDRIVVP* |
Ga0164301_102499791 | 3300012960 | Soil | AGGLGVFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0126369_102357433 | 3300012971 | Tropical Forest Soil | PFADRSNIRVVRRNGDKVIEYIADYDGIIKGDLKQDILLRPGDRIIVP* |
Ga0164308_101812492 | 3300012985 | Soil | GAAGGLGVFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0164306_115416092 | 3300012988 | Soil | TRAGGLGVFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR* |
Ga0157380_132893741 | 3300014326 | Switchgrass Rhizosphere | REGTKITEFIVDYDAIIKGDLKQDLLLRPGDRIIIP* |
Ga0157379_120618821 | 3300014968 | Switchgrass Rhizosphere | RAGGLGVFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP* |
Ga0137412_106809232 | 3300015242 | Vadose Zone Soil | LTRSGGLGVFADRSNIRVVRRDGSKVTEYVVDYDAIIKGDLKQDVLLRPGDRIIVP* |
Ga0132257_1009575491 | 3300015373 | Arabidopsis Rhizosphere | SNIRVVRREASRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP* |
Ga0132255_1008015882 | 3300015374 | Arabidopsis Rhizosphere | GSKVTEYVVDYDAIIKGDLKQDLLLRPGDRIIVP* |
Ga0132255_1013861882 | 3300015374 | Arabidopsis Rhizosphere | VVRRDGSKVTEYVVDYDAIIKGDLKQDVLLRPGDRIIVP* |
Ga0182035_106739202 | 3300016341 | Soil | FADRSNIRVVRREGNKETEYIADYDAMVKGDLKQDILLRPGDRIIVP |
Ga0163161_107262472 | 3300017792 | Switchgrass Rhizosphere | DRRNIRISRRQGEKITEFVVDYDAILEGDLKQDILLKPGDRIVVP |
Ga0184608_104077211 | 3300018028 | Groundwater Sediment | IFADRADIRVVRREGDKIKEYIVDYDAILKGDLKQAILVRPGDRIIVP |
Ga0187787_100577743 | 3300018029 | Tropical Peatland | DRSNIRLVRREGAKITEYVVDYDAIIKGDLKQDLLLRPGDRIIIP |
Ga0187787_104322481 | 3300018029 | Tropical Peatland | LITRMGGLGIFADRSNIRLVRREGTKITEYLVDYDAIIKGDLKQDLLLRPGDRIIIP |
Ga0184634_101069742 | 3300018031 | Groundwater Sediment | TIFADRRNIKLVRRDGNTVTEYIVDYDAIVQGDLRQDILLRPGDRIIVP |
Ga0184637_100303843 | 3300018063 | Groundwater Sediment | QLLTRAGGLTIFAQRRDIRTVRRAGEKVTEFISDYDAIVAGDLKQDILLRPGDRIIVP |
Ga0184618_102163431 | 3300018071 | Groundwater Sediment | RSNLRVVRREGDKLTEFIVDYDAIIKGDLKQDILLRPADRIIVP |
Ga0184612_105211292 | 3300018078 | Groundwater Sediment | RVVRRLGEKVTEYIVDYDAILEGDLKQDILLKPGDRVIVQ |
Ga0184625_104439811 | 3300018081 | Groundwater Sediment | IFADRSNIRVVRRDGDKVTEYIADYDGIIKGDLKQDILLRPGDRIIVP |
Ga0184639_102745151 | 3300018082 | Groundwater Sediment | IRIVRRDGVKITEYVVDYDAIIKGDLKQDLLLRPGDRVIIP |
Ga0184629_105696901 | 3300018084 | Groundwater Sediment | TGEKITEYVSDYDAIIDGDLKQDIILRPGDRIIVK |
Ga0190265_102423431 | 3300018422 | Soil | VRREGAKVTEYVVDYDAIVKGDLKQDILLRPGDRIIVP |
Ga0193726_13637652 | 3300020021 | Soil | FAERSNLRVVRREGDKLTEFIVDYDAIIKGDLKQDILLRPADRIIVP |
Ga0212128_107237402 | 3300022563 | Thermal Springs | ASRSNIRVVRREGEKVKEFTVDYDAIVAGDLKQDIPLKPGDRVIVP |
Ga0209521_106012111 | 3300025164 | Soil | TRAGGLTIFAQRRDIKTVRRAGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP |
Ga0209108_101954382 | 3300025165 | Soil | TIFAQRRDIKTVRRTGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP |
Ga0209642_100063357 | 3300025167 | Soil | TVRRTGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP |
Ga0207673_10516752 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | VFADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR |
Ga0209519_101097332 | 3300025318 | Soil | IKTVRRAGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP |
Ga0209641_107105631 | 3300025322 | Soil | AQRRDIKTVRRAGDKVTEYVSDYDAIVAGDLKQDIILRPGDRVIVP |
Ga0207642_110861122 | 3300025899 | Miscanthus Rhizosphere | LSPFADRRNIRISRRQGEKITEFVVDYDAILEGDLKQDILLKPGDRIVVP |
Ga0207670_116638441 | 3300025936 | Switchgrass Rhizosphere | ADRSNIRIVRREGTKITEFIVDYDAIIKGDLKQDLLLRPGDRIIIP |
Ga0207658_109070691 | 3300025986 | Switchgrass Rhizosphere | EGNRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP |
Ga0208685_10560881 | 3300027513 | Soil | RREGTKITEFIVDYDAIINGDLKQDLLLRPGDRIIIP |
Ga0209798_103455511 | 3300027843 | Wetland Sediment | FADRSNIRVVRREKDKITEYVIDYDAILKGDLRQDILLRPGDRIIVPEATLFFGK |
Ga0209798_105282962 | 3300027843 | Wetland Sediment | LNGNESLLQLITRAGGLTIFADRRNIKTVRRNGDRVMEFLSDYEAILTGDFKQDIILKPGDRIIVP |
Ga0209180_102044892 | 3300027846 | Vadose Zone Soil | NRDKIRVVRRAGEKVTEYIVDYDAILKGDLKQDILLRPGDRIIVQ |
Ga0209701_106936691 | 3300027862 | Vadose Zone Soil | MTIFADRHNIKIVRRQGDKVTEYIVDYDAIVRGDLKQDILLRPGDRIIVQ |
Ga0207428_112057482 | 3300027907 | Populus Rhizosphere | EGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVP |
Ga0209583_106304982 | 3300027910 | Watersheds | LTPFADRRNIRVSRRQGDKVVEFVVDYNAILGGDLKQDILLRPGDRIVVP |
Ga0268386_110104651 | 3300030619 | Soil | PLLGNDSLLQLITRAGGLTIFADRRDIRVLRRARNKVIEYIADYEAIIDGDLKQDIILRPGDRIIVQ |
Ga0310813_103542681 | 3300031716 | Soil | RREGSKITEYTVDYDAIIKGDLKQDLLLRPGDRIIIP |
Ga0307477_107512431 | 3300031753 | Hardwood Forest Soil | TILQLLSRMGGLGIFDDRKNIRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIV |
Ga0310900_111999552 | 3300031908 | Soil | FADRSNIRVVRRDGSRVTEYTVDYDAIIKGDLKQDVLLRPGDRVIVR |
Ga0214473_104841031 | 3300031949 | Soil | IRRVGEKVTEYIADYEAIIDGDLKQDIILRPGDRIIVK |
Ga0315912_103537342 | 3300032157 | Soil | GAYPMLGNDTLLQLVTRAGGLTIFAERRDIRVMRRLGNKVTEYIADYDAIVAGDLKQDIILRPGDRIIVP |
Ga0307471_1011985591 | 3300032180 | Hardwood Forest Soil | GLGIFDDRKNIRVVRRDGDKITEYIVDYDAIIKGDLKQDILLRPGDRIIVP |
Ga0307471_1016149951 | 3300032180 | Hardwood Forest Soil | LITRAGGLNLFADYHNIKVVRRNGADVTEYTVDFEAIMKGDLKQDILLRPGDRILVE |
Ga0335081_103981041 | 3300032892 | Soil | FDDRKNIRVVRRDGDKITEYIVDYDAIINGDLKQDILLRPGDRIIVP |
Ga0316617_1017217642 | 3300033557 | Soil | RMGNKVTEYIADYDAIVAGDLKQDIILRPGDRIIVP |
Ga0364930_0284123_3_125 | 3300033814 | Sediment | KTVRRAGDKVTEYVSDYDAIVAGDLKQDIILRPGDRIIVP |
⦗Top⦘ |