NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097616

Metagenome / Metatranscriptome Family F097616

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097616
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence MNGPLLISLLPPERIWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR
Number of Associated Samples 70
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 17.31 %
% of genes near scaffold ends (potentially truncated) 46.15 %
% of genes from short scaffolds (< 2000 bps) 75.96 %
Associated GOLD sequencing projects 63
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(21.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.385 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF06803DUF1232 3.85
PF08238Sel1 2.88
PF00571CBS 1.92
PF00107ADH_zinc_N 1.92
PF13620CarboxypepD_reg 1.92
PF01061ABC2_membrane 1.92
PF08240ADH_N 1.92
PF07690MFS_1 1.92
PF00294PfkB 0.96
PF00891Methyltransf_2 0.96
PF13418Kelch_4 0.96
PF13635DUF4143 0.96
PF00293NUDIX 0.96
PF13474SnoaL_3 0.96
PF13578Methyltransf_24 0.96
PF14539DUF4442 0.96
PF01609DDE_Tnp_1 0.96
PF04773FecR 0.96
PF02586SRAP 0.96
PF04389Peptidase_M28 0.96
PF02142MGS 0.96
PF03916NrfD 0.96
PF01161PBP 0.96
PF01135PCMT 0.96
PF01381HTH_3 0.96
PF01894UPF0047 0.96
PF02225PA 0.96
PF07589PEP-CTERM 0.96
PF02321OEP 0.96
PF12002MgsA_C 0.96
PF16116DUF4832 0.96
PF02518HATPase_c 0.96
PF16561AMPK1_CBM 0.96
PF05973Gp49 0.96
PF08734GYD 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 3.85
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.92
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.96
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.96
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.96
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.96
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.96
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.96
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.96
COG3293TransposaseMobilome: prophages, transposons [X] 0.96
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.96
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.96
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.96
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.96
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.96
COG5421TransposaseMobilome: prophages, transposons [X] 0.96
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.96
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.46 %
UnclassifiedrootN/A36.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003994|Ga0055435_10100636Not Available763Open in IMG/M
3300003994|Ga0055435_10209433Not Available564Open in IMG/M
3300004009|Ga0055437_10053158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)1091Open in IMG/M
3300004012|Ga0055464_10030480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1357Open in IMG/M
3300004050|Ga0055491_10034808All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300004778|Ga0062383_10029017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2037Open in IMG/M
3300004779|Ga0062380_10209585Not Available791Open in IMG/M
3300004781|Ga0062379_10020337Not Available1138Open in IMG/M
3300005830|Ga0074473_10150863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium 37-65-8872Open in IMG/M
3300005832|Ga0074469_11261282Not Available587Open in IMG/M
3300005833|Ga0074472_10564658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4293Open in IMG/M
3300005833|Ga0074472_11493854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1949Open in IMG/M
3300005889|Ga0075290_1023440All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006224|Ga0079037_100064662All Organisms → cellular organisms → Bacteria2932Open in IMG/M
3300006224|Ga0079037_100110551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2331Open in IMG/M
3300006224|Ga0079037_100233509All Organisms → cellular organisms → Bacteria → Acidobacteria1672Open in IMG/M
3300006224|Ga0079037_100453084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1224Open in IMG/M
3300006224|Ga0079037_101046764Not Available808Open in IMG/M
3300006224|Ga0079037_101494836Not Available674Open in IMG/M
3300006224|Ga0079037_102186217Not Available553Open in IMG/M
3300006930|Ga0079303_10210116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300007351|Ga0104751_1002421All Organisms → cellular organisms → Bacteria28993Open in IMG/M
3300009091|Ga0102851_10401263Not Available1380Open in IMG/M
3300009111|Ga0115026_10036974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2581Open in IMG/M
3300009111|Ga0115026_10181028Not Available1389Open in IMG/M
3300009111|Ga0115026_10865263Not Available712Open in IMG/M
3300009167|Ga0113563_11314757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)846Open in IMG/M
3300009296|Ga0103681_1012428All Organisms → cellular organisms → Bacteria4901Open in IMG/M
3300009538|Ga0129287_10008293All Organisms → cellular organisms → Bacteria5065Open in IMG/M
3300009868|Ga0130016_10304730All Organisms → cellular organisms → Bacteria1881Open in IMG/M
3300011264|Ga0151623_1418393All Organisms → cellular organisms → Bacteria → Proteobacteria1633Open in IMG/M
3300011407|Ga0137450_1105911Not Available550Open in IMG/M
3300012152|Ga0137347_1031108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae837Open in IMG/M
3300012673|Ga0137339_1003242Not Available1179Open in IMG/M
3300012931|Ga0153915_10006029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales11326Open in IMG/M
3300012931|Ga0153915_10094189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3166Open in IMG/M
3300012931|Ga0153915_11429881Not Available808Open in IMG/M
3300012931|Ga0153915_12995855Not Available550Open in IMG/M
3300012964|Ga0153916_11424050Not Available769Open in IMG/M
3300014305|Ga0075349_1040429All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300018055|Ga0184616_10130765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium917Open in IMG/M
3300021081|Ga0210379_10422193All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300024056|Ga0124853_1168607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium 21-66-52380Open in IMG/M
3300025034|Ga0210041_1074640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1477Open in IMG/M
3300025318|Ga0209519_10015461All Organisms → cellular organisms → Bacteria3942Open in IMG/M
3300025551|Ga0210131_1096293Not Available514Open in IMG/M
3300025790|Ga0210075_1010287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1508Open in IMG/M
3300025891|Ga0209585_10146995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria909Open in IMG/M
3300025950|Ga0210134_1025836All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300025966|Ga0210105_1026180All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300025968|Ga0210103_1008774All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300026030|Ga0208908_1005069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1182Open in IMG/M
3300026048|Ga0208915_1015294All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300026535|Ga0256867_10074538Not Available1336Open in IMG/M
3300027657|Ga0256865_1002203All Organisms → cellular organisms → Bacteria6094Open in IMG/M
3300027716|Ga0209682_10106796Not Available708Open in IMG/M
3300027843|Ga0209798_10162221All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300027843|Ga0209798_10182537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_64_851041Open in IMG/M
3300027871|Ga0209397_10375764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300027877|Ga0209293_10014847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2636Open in IMG/M
3300027877|Ga0209293_10584600Not Available589Open in IMG/M
3300028032|Ga0265296_1187818All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91726Open in IMG/M
3300031746|Ga0315293_10380196Not Available1115Open in IMG/M
3300031772|Ga0315288_10197177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2191Open in IMG/M
3300031834|Ga0315290_11365747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → unclassified Deinococcus → Deinococcus sp. TS-293581Open in IMG/M
3300031949|Ga0214473_10042844All Organisms → cellular organisms → Bacteria5306Open in IMG/M
3300031949|Ga0214473_10228167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2147Open in IMG/M
3300031949|Ga0214473_11074578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300031949|Ga0214473_12397624Not Available503Open in IMG/M
3300031965|Ga0326597_10010459All Organisms → cellular organisms → Bacteria → Proteobacteria12359Open in IMG/M
3300031965|Ga0326597_11010150Not Available839Open in IMG/M
3300031997|Ga0315278_10108483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2805Open in IMG/M
3300031997|Ga0315278_10198089Not Available2066Open in IMG/M
3300031997|Ga0315278_10215906All Organisms → cellular organisms → Bacteria → Proteobacteria1975Open in IMG/M
3300031997|Ga0315278_10628083Not Available1097Open in IMG/M
3300031997|Ga0315278_11274440Not Available717Open in IMG/M
3300031997|Ga0315278_11512591Not Available645Open in IMG/M
3300032163|Ga0315281_12154278Not Available529Open in IMG/M
3300032164|Ga0315283_12048151Not Available568Open in IMG/M
3300032177|Ga0315276_10304801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1693Open in IMG/M
3300032342|Ga0315286_11298618All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300032397|Ga0315287_11225016Not Available863Open in IMG/M
3300032401|Ga0315275_10432164All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. CG24A1476Open in IMG/M
3300032401|Ga0315275_11276553Not Available796Open in IMG/M
3300032516|Ga0315273_10207135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_65_92681Open in IMG/M
3300032516|Ga0315273_10305156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2160Open in IMG/M
3300032516|Ga0315273_12139397Not Available659Open in IMG/M
3300033233|Ga0334722_10138625All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300033408|Ga0316605_11157656Not Available746Open in IMG/M
3300033413|Ga0316603_10058020All Organisms → cellular organisms → Bacteria2867Open in IMG/M
3300033413|Ga0316603_10511822All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300033413|Ga0316603_10525935All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300033413|Ga0316603_10658241Not Available976Open in IMG/M
3300033413|Ga0316603_11093755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)754Open in IMG/M
3300033414|Ga0316619_10032916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2691Open in IMG/M
3300033419|Ga0316601_100068339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2728Open in IMG/M
3300033419|Ga0316601_100867480Not Available895Open in IMG/M
3300033480|Ga0316620_10397390Not Available1244Open in IMG/M
3300033481|Ga0316600_10102739All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300033485|Ga0316626_11017741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria735Open in IMG/M
3300033485|Ga0316626_11923136Not Available535Open in IMG/M
3300033521|Ga0316616_101231030Not Available953Open in IMG/M
3300033521|Ga0316616_104523544All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium RBG_19FT_COMBO_58_17523Open in IMG/M
3300033814|Ga0364930_0038905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1613Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment19.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil14.42%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands9.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands9.62%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland5.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment5.77%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands4.81%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil3.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.88%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.96%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.96%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.96%
Deep Subsurface AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer0.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.96%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004012Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004781Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2FreshEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007351Combined Assembly of Gp0115775, Gp0115815EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009296Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2umEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300011264Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63EnvironmentalOpen in IMG/M
3300011407Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012673Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014305Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025034Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025790Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025950Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025966Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025968Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026030Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd (SPAdes)EnvironmentalOpen in IMG/M
3300026048Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027657Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeqEnvironmentalOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055435_1010063623300003994Natural And Restored WetlandsMNGPLLFSILPPERIWDSSTAISDYTPFVAILLLIGFLLSLFLRQPGR*
Ga0055435_1020943313300003994Natural And Restored WetlandsPMNGPLLITLLPPEKLLDSTGAIPVYEPSIALLLLIGFLLSLFLRHPRR*
Ga0055437_1005315813300004009Natural And Restored WetlandsMNGPLLITLLPPEKLLDSTGAIPVYEPSIALLLLIGFLLSLFLRHPRR*
Ga0055464_1003048023300004012Natural And Restored WetlandsGPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH*
Ga0055491_1003480813300004050Natural And Restored WetlandsNKPLLISLLPPEQTWDFAVAIPSYTPFLAILLLIGFLLSHLLRHPGR*
Ga0062383_1002901723300004778Wetland SedimentMNGPLLISLLPPEKLLDATGTVPVYEPFIVVLLLIGFLLSLFLRHPRG*
Ga0062380_1020958523300004779Wetland SedimentMNGPLLIGLLPPEKLLDSTGAALVYEPFIAVLLLIGFLLSLFLRHPRR*
Ga0062379_1002033713300004781Wetland SedimentMNGPLLISLLPPEQTWNFADAVPSYTPFVAILLLIGFLLSLFLRHPGR*
Ga0074473_1015086323300005830Sediment (Intertidal)MNGPLLISLLPPDQTWNFADAVPGYLPFVAILLLIGFLLSILLRQPDRS*
Ga0074469_1126128233300005832Sediment (Intertidal)MNGPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH*
Ga0074472_1056465863300005833Sediment (Intertidal)MNGPLLVSLLPPEKLLDSTGAVPVYEPSIAVLLLIGFLLSLLLRHPGRG*
Ga0074472_1149385443300005833Sediment (Intertidal)MYGPLLISLLPPERTLDSAAAVSGAAPLVAILLLIGLLLSLWLRPPER*
Ga0075290_102344023300005889Rice Paddy SoilVNGPLLISLLPPERAWDSAVAVSDAAPIIFLLLLAGFLLSLFLRRPER*
Ga0079037_10006466223300006224Freshwater WetlandsMNGPLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR*
Ga0079037_10011055123300006224Freshwater WetlandsMNGPLLISLLPPEKFLDSTGATPVYEPFIAVLLLIGFLLSLLLRHPGR*
Ga0079037_10023350933300006224Freshwater WetlandsMNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGVDRNSA
Ga0079037_10045308423300006224Freshwater WetlandsMNGPLLISLLPPERVWDSASAVSGSTPYIAVFLLIGFLLSLLLRHPER*
Ga0079037_10104676413300006224Freshwater WetlandsMNGPLLISLLPPERIWDSATDISDSTPFVAILLLIGFLLSLLLRHPGR*
Ga0079037_10149483623300006224Freshwater WetlandsMNGPLLISLLPPERIWDSAAAISDPTPFVAVFLLIGYLLSLLLRHPGR*
Ga0079037_10218621713300006224Freshwater WetlandsMNGPLLVSLLPPERTWDSATATSDSTPYIAILLLIGFLLSLLLRHPSR*
Ga0079303_1021011623300006930Deep SubsurfaceMNGPLLIDLLPPEKLLDPTGVVPVSAPFIAVLLLIGFLLSLMLRPP
Ga0104751_1002421273300007351Deep Subsurface AquiferMNGPLLISLLPPERSLESAAAVAGSPIVVAVLLLAGLFLSLVLRRP*
Ga0102851_1040126323300009091Freshwater WetlandsMNGPLLISLLPPERIWDSSTAISDSTPIIAIFLLIGFLLSLVLRHPG*
Ga0115026_1003697433300009111WetlandMNGPLLISLLPPEKLLDSTGTVPITEPFIAILLLIGFLLSLVLRHPER*
Ga0115026_1018102823300009111WetlandMNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGR*
Ga0115026_1086526313300009111WetlandMNGPLLISLLPPERVWDSATATSDSTPFVATLLLIGFLLSLLLRQTGR*
Ga0113563_1131475723300009167Freshwater WetlandsMNGPILVSLLPPERIWDSAAATSDSTPFVAVFLLIGYLLSLTLLSADCP
Ga0103681_101242863300009296GroundwaterMNAPLLVSLLPPEWPAGSEAAVSASAPFVAILLLAGLLLSLVLRHPGR*
Ga0129287_1000829363300009538Beach Aquifer PorewaterMNGPLLVSLLPLERMWDTTAVVSGFVPFVAILLLIGFLLSLFLRHPGR*
Ga0130016_1030473023300009868WastewaterMNGPLLIQLLPPERIWDLTGAVPDAAPSIAILLLAGFLLSFLLRHPGG*
Ga0151623_141839313300011264SedimentMNGPLLISMLPPETLTDAAGAVPPYDPFIAVLLLAGLLLSLLLRPSGR*
Ga0137450_110591123300011407SoilMNGPLLISLLPPDRSWDSAPAISGSAPFIAILLLIGILLSLFLRHPER*
Ga0137347_103110823300012152SoilMNGPLLISLLPPEWSWDSAAAISGSPPFIAILLLIGFLLSLFLR
Ga0137339_100324223300012673SoilMNGPLLISLLPPDRSWDSAPAISGSAPFIAILLLIGILLSLFLRHPDR*
Ga0153915_1000602923300012931Freshwater WetlandsMQALYGPLLISLLPPEGSWDSAPAISSATPFIAILLLIGLLLSLLLRHPRG*
Ga0153915_1009418933300012931Freshwater WetlandsMNGPLLISLLPPEQTWDSTATVSGFMPFIAILLLIGLLLSLYLRHPER*
Ga0153915_1142988123300012931Freshwater WetlandsMYGPLLVSLLPPEKLLDATGMLPVYEPFIAVLLLIGFLLSLFLLHPGR*
Ga0153915_1299585513300012931Freshwater WetlandsMNGPLLISLLPPERIWDSSTAISDSTPIIAIILLIGFLLSLVLRHPG*
Ga0153916_1142405023300012964Freshwater WetlandsLPPEKLLDATGTLPVYEPFIAVLLLIGFLLSLFLLHPGR*
Ga0075349_104042913300014305Natural And Restored WetlandsMNGPLLVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS*
Ga0184616_1013076513300018055Groundwater SedimentMNGPLLISLLPPERIWESAVANSGFTPFVAILLLIGFLLSLFLRHPGRG
Ga0210379_1042219313300021081Groundwater SedimentMNGPLLISLLPPERIWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR
Ga0124853_116860733300024056Freshwater WetlandsMNGPLLISLLPPEGNLDSIAAISDSTPFVAILLLIGFLLSLFLRHPER
Ga0210041_107464013300025034AquiferLVSLLPPEHAWDSAAATSGSTSFIAILLLVGFLLSLLLRHPGR
Ga0209519_1001546153300025318SoilMNGPLLVSLLPPEHAWDSAMSIPGSTPLVAILLLIGFLLILFLRHPRR
Ga0210131_109629313300025551Natural And Restored WetlandsMNGPLLTSLLPPERIWDTVTATSDSTPFVAILLLIGFLLSLLLRH
Ga0210075_101028713300025790Natural And Restored WetlandsPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH
Ga0209585_1014699513300025891Arctic Peat SoilPLLISLLPPEQTWDSAAATSGSTPFVAILLLIGFLLSLFLRHPGR
Ga0210134_102583613300025950Natural And Restored WetlandsLVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS
Ga0210105_102618023300025966Natural And Restored WetlandsSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS
Ga0210103_100877413300025968Natural And Restored WetlandsMNGPLLVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS
Ga0208908_100506913300026030Natural And Restored WetlandsDSMNGPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH
Ga0208915_101529423300026048Natural And Restored WetlandsMNGPLLISLLPPEKLLDSTGAVPVYDPFIAVLLLIGF
Ga0256867_1007453823300026535SoilMNGPLLVSLLPPERIGDSASAISGTTPFVAILLLIGFLLSLFLRHPER
Ga0256865_100220333300027657SoilMNGPLLVSLLPPERSWEYASSLSDSTPFVAVLLLIGFLLSLFLRHPER
Ga0209682_1010679613300027716Wetland SedimentMNGPLLISLLPPEKLLDATGTVPVYEPFIVVLLLIGFLLSLFLRHPRG
Ga0209798_1016222133300027843Wetland SedimentPEKLLDSTGAVPVYEPFIVVLLLIGFLLSLFLRHPGR
Ga0209798_1018253713300027843Wetland SedimentMNGPLLISLLPPEKLLDSTGAAPVYAPFIAVLLLIGFFL
Ga0209397_1037576423300027871WetlandMNGPLLIDLLPPEKLLDSTGVVPVPAPFIAALLLIGFLLSLMLR
Ga0209293_1001484723300027877WetlandMNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGR
Ga0209293_1058460013300027877WetlandMNGPLLVSLLPPERIWDSAVGISDSTPFVAVLLLIGFLLSLLL
Ga0265296_118781813300028032GroundwaterMNGPLLISLLPPERSWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR
Ga0315293_1038019623300031746SedimentMNGPLLISLLPPEKLLDSTVAVPVYEPFIAVLLLIGFLLSLLLRHPKR
Ga0315288_1019717723300031772SedimentMNGPLLVSLLPPEKLLDSTGAVPVYEPSIAVLLPIGFLLSLLLRHPGRG
Ga0315290_1136574713300031834SedimentMNGPLLVSLLPPEKLLNSAGAVPVYEPYIAVLLLIGFL
Ga0214473_1004284433300031949SoilMNGPLLISLLPPEKMMESPGAIPGYAQFIAVLLLIGFLLSLFLRHPER
Ga0214473_1022816723300031949SoilMNGPLLVTLLPPERSWDSASSLSGSTPFIAILLLIGFLLSLFLRHPGR
Ga0214473_1107457813300031949SoilMNGPLLISLLPPERIWDSAVAISDSTPFVAILLVIGFLLS
Ga0214473_1239762423300031949SoilMNGPLLISLLPPEKLIDSTGAAPVYEPFIAVLLLIGFLLSLLLRHPGR
Ga0326597_1001045943300031965SoilMNGPLLVSLLPPEHAWDSAMSIPGSTPLVAILLLIGFLLTLFLRHPGR
Ga0326597_1101015013300031965SoilMNGPLLVSLLPPEHAWDSAMSIPGSTPFVAILLLIGFLLTLFLRHPGR
Ga0315278_1010848353300031997SedimentMNGPLLISLLPPEKLLDSTGAAPVYEPFIVVLLLIGFL
Ga0315278_1019808913300031997SedimentSMNGPLLISLLPPEKLLDSTGAVQVDEPFIAVLLLIGFLLSLFLRHPGRG
Ga0315278_1021590633300031997SedimentMNGPLLISLLPPEKLLDSTGAVQVDEPFIAVLLLIGFLLS
Ga0315278_1062808323300031997SedimentMNGPLLINLLPPEKLLDSTGAVPVYEPSIAVLLLIGFLLSILLRHPER
Ga0315278_1127444023300031997SedimentPLLISLLPPEKLSDSTGAVPVYEPLIAVLLLIGFLLSLFLRHPGR
Ga0315278_1151259113300031997SedimentMNGPLLVSLLPQEKLLDATVTVAVPVYEPFIAVLLLIGFLLSL
Ga0315281_1215427823300032163SedimentMNGPLLISLLPPEKLLDSTVAVPVYEPFIAVLLLIGFLLSLLL
Ga0315283_1204815113300032164SedimentDFMNGPLLISLLPPEKLLDSTGAAPVYEPFIVVLLLIGFLLSILLRQPDP
Ga0315276_1030480123300032177SedimentMNGPLLISLLPPEKLLDSTGAVPVYEPFIAVLLLIGFLLSLLLRHPRR
Ga0315286_1129861823300032342SedimentMNGPLLISLLPPEKLLDSTGAALVYEPFIAVLLLVGFLLSLFLRHPER
Ga0315287_1122501623300032397SedimentMNGPLLISLLPPERLLDSTVGAIPVYEPFIIAVLLLIGFL
Ga0315275_1043216413300032401SedimentNGPLLISLLPPEKLLESAGAVPVYEPFIIAVLLLIGFLLSILLKQPDRS
Ga0315275_1127655313300032401SedimentMNGPLLISLLPPERLLDSTVGAIPVYEPFIIAVLLLIGFLLSLLLRHP
Ga0315273_1020713533300032516SedimentMNGPLLISLLPPEKLLDSTGAVPVYAPFIAVLLLIGFLL
Ga0315273_1030515643300032516SedimentMNGPLLIGLLPPEKLLDSTGAVPVYEPFIAVLLLIGFLLSLLLRHPKR
Ga0315273_1213939713300032516SedimentMNGPLLISLLSPEKLLDPTGAVPVYEPLIAVLLLI
Ga0334722_1013862533300033233SedimentMNGPLLISLLPPEWSWDSAAAISGSPPFIAILLLIGFLLSLFLRHPGR
Ga0316605_1115765623300033408SoilVNLLPPERIWDSATATSDSTPFVAILLLIGFLLSLFLRQPGR
Ga0316603_1005802013300033413SoilMNGPLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR
Ga0316603_1051182223300033413SoilMNGPLLISLLPPERIWDSSTAISDYTPFVAILLLIGFLLSLFLRQPGRL
Ga0316603_1052593513300033413SoilMNGPLLISLLPSEKLLDSTEVVPVYEPFIAVLLLIGFLLSLMLR
Ga0316603_1065824113300033413SoilMNGPLLTSLLPPERIWDSTAAISDYTPFVAILLLIGFLLSLML
Ga0316603_1109375513300033413SoilMNGPLLVSLLPPERIWDSAVAISDSTPFVAVFLLIGFLLSLLLRHPGR
Ga0316619_1003291633300033414SoilMNGPLLISLLPPERIWDSSTAISDSTPIIAIFLLIGFLLSLVLRHPG
Ga0316601_10006833913300033419SoilMNGPLLVSLLPPERIWDSAVGISDSTPFVAVLLLIGFLLS
Ga0316601_10086748013300033419SoilMNGPLLISLLPPEKFLDSTGATPVYEPFIAVLLLIGFLLSLL
Ga0316620_1039739023300033480SoilMNGPLLISLLPPERIWDSSTAISDFTPIIAIILLIGFLLSLVLRHPG
Ga0316600_1010273913300033481SoilMNGPLLISLLPPERILDSSTAISDYTPFVAILLLIGFLLSLFLRQPGR
Ga0316626_1101774123300033485SoilMYGPLLIRLLPPERTWDSPFAVSGSTPFIAILLLLGFLPSLF
Ga0316626_1192313623300033485SoilMNGPLVVSLLPPERIWDSASAVSGSTPYIAVFLLIGFLLSLLLRHPR
Ga0316616_10123103023300033521SoilPPEKLLDPTGVVPVSAPFIAVLLLIGFLLSLMLRPPRG
Ga0316616_10452354413300033521SoilPLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR
Ga0364930_0038905_1471_16113300033814SedimentMNGPLLVSLLPPEWTWDSAAAASGSSPFVAILLLIGFLLSLFLRHPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.