NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097661

Metagenome / Metatranscriptome Family F097661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097661
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 66 residues
Representative Sequence MSIEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELD
Number of Associated Samples 88
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 69.23 %
% of genes near scaffold ends (potentially truncated) 19.23 %
% of genes from short scaffolds (< 2000 bps) 83.65 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (36.538 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.961 % of family members)
Environment Ontology (ENVO) Unclassified
(79.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.269 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.26%    β-sheet: 15.22%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01726LexA_DNA_bind 4.85
PF11171DUF2958 2.91
PF13662Toprim_4 0.97
PF13730HTH_36 0.97
PF13155Toprim_2 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.12 %
UnclassifiedrootN/A27.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10085173All Organisms → Viruses → Predicted Viral1379Open in IMG/M
3300000101|DelMOSum2010_c10219573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197621Open in IMG/M
3300000115|DelMOSum2011_c10046917All Organisms → Viruses → Predicted Viral1747Open in IMG/M
3300000116|DelMOSpr2010_c10082529All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300000116|DelMOSpr2010_c10160984Not Available757Open in IMG/M
3300000117|DelMOWin2010_c10050846All Organisms → Viruses → Predicted Viral1830Open in IMG/M
3300000117|DelMOWin2010_c10158127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197740Open in IMG/M
3300000117|DelMOWin2010_c10242766Not Available531Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1012314All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1003287All Organisms → Viruses → Predicted Viral4470Open in IMG/M
3300001450|JGI24006J15134_10061993Not Available1473Open in IMG/M
3300001450|JGI24006J15134_10213038Not Available580Open in IMG/M
3300001460|JGI24003J15210_10042319All Organisms → Viruses → Predicted Viral1571Open in IMG/M
3300001460|JGI24003J15210_10119316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197722Open in IMG/M
3300001460|JGI24003J15210_10157374Not Available574Open in IMG/M
3300001472|JGI24004J15324_10069268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197987Open in IMG/M
3300004460|Ga0066222_1208865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197503Open in IMG/M
3300005078|Ga0070770_10402411Not Available500Open in IMG/M
3300005837|Ga0078893_10167635All Organisms → Viruses → Predicted Viral2102Open in IMG/M
3300006193|Ga0075445_10314135Not Available528Open in IMG/M
3300006403|Ga0075514_1674781All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300006735|Ga0098038_1040709All Organisms → Viruses → Predicted Viral1706Open in IMG/M
3300006735|Ga0098038_1113990Not Available923Open in IMG/M
3300006737|Ga0098037_1213914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197627Open in IMG/M
3300006737|Ga0098037_1279901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197530Open in IMG/M
3300006749|Ga0098042_1023778All Organisms → Viruses → Predicted Viral1781Open in IMG/M
3300006868|Ga0075481_10293488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197567Open in IMG/M
3300006916|Ga0070750_10059748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1827Open in IMG/M
3300006920|Ga0070748_1003752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1976900Open in IMG/M
3300006947|Ga0075444_10132396Not Available1060Open in IMG/M
3300007231|Ga0075469_10092714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197855Open in IMG/M
3300007236|Ga0075463_10001781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1977292Open in IMG/M
3300007973|Ga0105746_1264870Not Available593Open in IMG/M
3300007974|Ga0105747_1132373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197797Open in IMG/M
3300007992|Ga0105748_10367118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197618Open in IMG/M
3300008050|Ga0098052_1126249All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300009420|Ga0114994_10154852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1551Open in IMG/M
3300009428|Ga0114915_1145133Not Available677Open in IMG/M
3300009435|Ga0115546_1009736All Organisms → Viruses → Predicted Viral4495Open in IMG/M
3300009445|Ga0115553_1239345Not Available713Open in IMG/M
3300009481|Ga0114932_10734576All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes573Open in IMG/M
3300009526|Ga0115004_10506805Not Available714Open in IMG/M
3300009601|Ga0114914_1076220Not Available510Open in IMG/M
3300010148|Ga0098043_1011936All Organisms → Viruses → Predicted Viral2860Open in IMG/M
3300010153|Ga0098059_1237093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197705Open in IMG/M
3300011128|Ga0151669_124246All Organisms → Viruses → Predicted Viral2436Open in IMG/M
3300011253|Ga0151671_1032029Not Available506Open in IMG/M
3300011253|Ga0151671_1036451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197845Open in IMG/M
3300012920|Ga0160423_11070914All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156539Open in IMG/M
3300017706|Ga0181377_1012699All Organisms → Viruses → Predicted Viral1982Open in IMG/M
3300017708|Ga0181369_1016276All Organisms → Viruses → Predicted Viral1843Open in IMG/M
3300017710|Ga0181403_1017856All Organisms → Viruses → Predicted Viral1512Open in IMG/M
3300017717|Ga0181404_1053988All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300017721|Ga0181373_1022741All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300017725|Ga0181398_1097687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagivirus S35C6701Open in IMG/M
3300017742|Ga0181399_1133654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197602Open in IMG/M
3300017743|Ga0181402_1140048Not Available616Open in IMG/M
3300017743|Ga0181402_1140048Not Available616Open in IMG/M
3300017744|Ga0181397_1180562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197532Open in IMG/M
3300017749|Ga0181392_1017222All Organisms → Viruses → Predicted Viral2320Open in IMG/M
3300017763|Ga0181410_1221759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197513Open in IMG/M
3300017824|Ga0181552_10167962All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300018036|Ga0181600_10109127All Organisms → Viruses → Predicted Viral1612Open in IMG/M
3300018420|Ga0181563_10147681All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300020051|Ga0181555_1007554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1977650Open in IMG/M
3300020347|Ga0211504_1069601Not Available814Open in IMG/M
3300020352|Ga0211505_1138095Not Available576Open in IMG/M
3300020358|Ga0211689_1041719All Organisms → Viruses → Predicted Viral1381Open in IMG/M
3300020382|Ga0211686_10122316All Organisms → Viruses → Predicted Viral1069Open in IMG/M
3300020438|Ga0211576_10669652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197511Open in IMG/M
3300020469|Ga0211577_10533883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197707Open in IMG/M
3300021373|Ga0213865_10093775All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300021957|Ga0222717_10016867All Organisms → Viruses → Predicted Viral4945Open in IMG/M
3300021957|Ga0222717_10318968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197881Open in IMG/M
3300022065|Ga0212024_1003781All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300022069|Ga0212026_1046617Not Available651Open in IMG/M
3300022158|Ga0196897_1035567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197596Open in IMG/M
3300022183|Ga0196891_1019065All Organisms → Viruses → Predicted Viral1317Open in IMG/M
3300024185|Ga0228669_1014388All Organisms → Viruses → Predicted Viral1945Open in IMG/M
3300024296|Ga0228629_1042726All Organisms → Viruses → Predicted Viral1228Open in IMG/M
3300024417|Ga0228650_1045647All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300025099|Ga0208669_1004232All Organisms → Viruses → Predicted Viral4572Open in IMG/M
3300025101|Ga0208159_1037094All Organisms → Viruses → Predicted Viral1072Open in IMG/M
3300025103|Ga0208013_1070976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197912Open in IMG/M
3300025120|Ga0209535_1051957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1740Open in IMG/M
3300025120|Ga0209535_1072939Not Available1337Open in IMG/M
3300025120|Ga0209535_1095840All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300025138|Ga0209634_1026332All Organisms → cellular organisms → Bacteria3146Open in IMG/M
3300025621|Ga0209504_1028612Not Available1966Open in IMG/M
3300025645|Ga0208643_1002526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1979009Open in IMG/M
3300025671|Ga0208898_1183967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197524Open in IMG/M
3300027522|Ga0209384_1026460All Organisms → Viruses → Predicted Viral1766Open in IMG/M
3300027522|Ga0209384_1044317Not Available1230Open in IMG/M
3300027668|Ga0209482_1015422Not Available3475Open in IMG/M
3300027672|Ga0209383_1038708Not Available1870Open in IMG/M
3300027813|Ga0209090_10138662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1291Open in IMG/M
3300029448|Ga0183755_1009821All Organisms → Viruses → Predicted Viral3848Open in IMG/M
3300029448|Ga0183755_1017250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2518Open in IMG/M
3300031510|Ga0308010_1208348Not Available704Open in IMG/M
3300031519|Ga0307488_10496533Not Available730Open in IMG/M
3300031628|Ga0308014_1024044Not Available1579Open in IMG/M
3300031658|Ga0307984_1012805Not Available2979Open in IMG/M
3300031851|Ga0315320_10299327All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300034418|Ga0348337_111972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197859Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.96%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.46%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.50%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine7.69%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.85%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.88%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.88%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.88%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.88%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.92%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.92%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.96%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.96%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.96%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.96%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.96%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300024185Seawater microbial communities from Monterey Bay, California, United States - 84DEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1008517313300000101MarineIENFDEYCEGNYFSEDVAVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIEEELG*
DelMOSum2010_1021957313300000101MarineMSKLKQTIIIENLDEYCEGIYFADDTAVKVDLQNGKINTVAFCICKETAKGMAKGLNLYDNIEEELG*
DelMOSum2011_1004691733300000115MarineMKAITKNNIVIENFDEYCEGNYFSEDVAVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIEEELG*
DelMOSpr2010_1008252953300000116MarineMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ*
DelMOSpr2010_1016098423300000116MarineMRNKTEITKKNLEEFCEGNYFSDDVAIKYDLQNGKINTVAFCICKKTAQDMAKALNLLDYIKEYD*
DelMOWin2010_1005084673300000117MarineKQTIIIENLDEYCEGIYFADDTAVKVDLQNGKINTVAFCICKETAKGMAKGLNLYDNIEEELG*
DelMOWin2010_1015812723300000117MarineMSIEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTISFCICKGTARDMAKGLNLYDNIIEELNQ*
DelMOWin2010_1024276623300000117MarineMTNKKDVLKYIQITKENLEESCDGNYFSDDVAVKYDLQNGEINVVAYCICKATANGMAKGLNLYNNLKEEL*
LPaug09P1610mDRAFT_101231473300000149MarineMSKLKQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELG*
LP_A_09_P04_10DRAFT_1003287133300000265MarineMKAITKNNIVIENFDEYCEGNYFSEDVAVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIEEELR*
JGI24006J15134_1006199323300001450MarineMAKEILRYIQITKENLEESCEGNYFSEDVAVKYDLQNGTINTVAFCICKKTAQDMAKGLNLYDGLKEEL*
JGI24006J15134_1021303823300001450MarineMTNKIEITKENLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL*
JGI24003J15210_1004231933300001460MarineMKNIDISKDNIDEITDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELD*
JGI24003J15210_1011931613300001460MarineMTNIDINKDNITEITDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIIEELD*
JGI24003J15210_1015737413300001460MarineQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELG*
JGI24004J15324_1006926813300001472MarineMSKLNQTIIIENLDEYCEGNYFSDDVAVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIEEELG*
Ga0066222_120886533300004460MarineMSIEITKENIDELTDGNYFSEDVAVKYDLQNGKINTVSFCICKGTARDTAKGLNLYDNIMEELG
Ga0070770_1040241123300005078WaterKKVITELSDGNYFSDETAVKYDLQNGKINVVAYCICKKTAEDMAKGLNLYDNVVEELDANIW*
Ga0078893_1016763563300005837Marine Surface WaterMTNIDINKDNITEITDGNYFSDDTAVKFDRQNGRLSTVAFCIDKQTARDMAKGLNLYDNIMEELD*
Ga0075445_1031413523300006193MarineMENKIEITKENLEESCEGNYFSDDVAVKFDEQNGKIYVVAYCICKNTAKGMAKGLNLYNNLEEEL*
Ga0075514_167478143300006403AqueousMSVEISKDNIDEMTEGNYFSEDTAIKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ*V*
Ga0098038_104070963300006735MarineMSIEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELD*
Ga0098038_111399013300006735MarineTHITKQYMKKKMRRSMTNIDINKDNITEITDGNYFADDTAVEFDRQNGRLSTVAFCIDNQTARDMAKGLNLYDNIMEELDD*
Ga0098037_121391423300006737MarineMTNIDISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQ*V*
Ga0098037_127990123300006737MarineMTNIDINQDNINEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDSIIEELDD*TNT*
Ga0098042_102377863300006749MarineMTNIDINKNNITEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDSIIEELDD*TNT*
Ga0075481_1029348813300006868AqueousMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ*V*
Ga0070750_1005974823300006916AqueousMTNKIEITKENLEESCDGNYFSDDVAVKYDLQNGEINVVAYCICKNTANSMAKGLNLYNNLKEEL*
Ga0070748_100375253300006920AqueousMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTISFCICKGTARDTAKGLNLYDNIMEELG*
Ga0075444_1013239623300006947MarineMENKIEITKENLEESCEGNYFSDDVAVKYDLQNGKINTVAFCICKKTAQDMAKGLNLYDDLREEL*
Ga0075469_1009271453300007231AqueousMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTISFCICKGTARDTAKGLNLYD
Ga0075463_10001781163300007236AqueousMSVEISKDNIDEMTEGNYFSEDTAIKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ*
Ga0105746_126487023300007973Estuary WaterMSKLNQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELG*
Ga0105747_113237323300007974Estuary WaterMSIKISKDNIDEMTDGNYFSEDTAVKYDLQNGLINTVAFCICKGTARDMAKGLNLYDNVIEELNQ*
Ga0105748_1036711833300007992Estuary WaterMSIETAKNNIVIENFDEYCEGNYFSEDVSVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIE
Ga0098052_112624933300008050MarineMSIKISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQ*
Ga0114994_1015485233300009420MarineMINKIEITKKNLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKQTAKDMAKGLNLYDGLKEEL*
Ga0114915_114513323300009428Deep OceanMEDRKVEITKENLEESCDGDYFSDDVAVKYDLRNGTINVVAYCICKNTAEGMANGLNLYNNLKEEL*
Ga0115546_100973623300009435Pelagic MarineMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTISFCICKGTARDMAKGLNLYDNIIEELNQ*
Ga0115553_123934543300009445Pelagic MarineMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCICKETARDMAKGLNLYDNIIEELNQ*
Ga0114932_1073457623300009481Deep SubsurfaceMKITKENYNELCEGNYWSDDVAVKYDLQNGQMNTVAFCICKKTAQDMAKALNLLDCISEEI*
Ga0115004_1050680533300009526MarineMTNKKDVLKYIQITRENLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKKTAKDMAKGLNLYDGLKEEL*
Ga0114914_107622023300009601Deep OceanMENKIEITKENLEESCDGNYFSDDVAVKFDEQNGKIYVVAYCICKNTAKGMAKGLNLYNNLEEEL*
Ga0098043_1011936103300010148MarineMTNIDINKNNITEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDNIMEELDD*
Ga0098059_123709323300010153MarineMSIEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQ*
Ga0151669_12424693300011128MarineMTNIEISKDNIDEMTDGHYFSEDTAVKYDLQNGTINTIAFCICKGTARDMAKGLNLYDNIIEELD*
Ga0151671_103202933300011253MarineYMKKKMRRSMTNIEISKDNIDEMTDGHYFSEDTAVKYDLQNGTINTIAFCICKGTARDMAKGLNLYDNIIEELD*
Ga0151671_103645133300011253MarineMSIEISKDNIDEMTDGHYFSEDTAVKYDLQNGTINTIAFCICKGTARDMAKGLNLYDNIIEELNQ*
Ga0160423_1107091423300012920Surface SeawaterMTNIDINQDNINEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDNIEEELG*
Ga0181377_101269983300017706MarineMSIEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQXV
Ga0181369_101627663300017708MarineMTNIDISKDNIDEMTDGNYFFEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIMEELDD
Ga0181403_101785613300017710SeawaterMTNIDINKDNITEITDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNI
Ga0181404_105398843300017717SeawaterMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCICKGTARDIAKGLNLYDNIIEELD
Ga0181373_102274133300017721MarineMTNIDINKNNITEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDNIMEELDDXTNT
Ga0181398_109768713300017725SeawaterMSKLNQTIIIENLDEYCEGNYFSDDVAVKYDLQNGKINTVAFCICPKTAEDMAKSLNLLDHLEQDGIELKQQASEQKG
Ga0181399_113365423300017742SeawaterMTNIDINKDNITEITDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIMEELD
Ga0181402_114004813300017743SeawaterRRYNYKGGXLMNIDKKVITELSDGNYFSDETAVKYDLQNGKINVVAYCICKKTAEDMAKGLNLYDNVKEELDANIW
Ga0181402_114004823300017743SeawaterMSKLNQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELGXVDIM
Ga0181397_118056223300017744SeawaterMNIDKKVITELSDGNYFSDETAVKYDLQNGKINVVAYCICKKTAEDMAKGLNLYDNVKEE
Ga0181392_101722223300017749SeawaterMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIMEELDTWLKLNKQS
Ga0181410_122175923300017763SeawaterMTNIDISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDIAKGLNLYDNIIEELD
Ga0181552_1016796233300017824Salt MarshMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGSINTVSFCIDSQTARDMAKGLNLYDNIIEELNQXV
Ga0181600_1010912723300018036Salt MarshMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQXV
Ga0181563_1014768163300018420Salt MarshMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGSINTVSFCIDSQTARDMAKGLNLYDNIIEELNQ
Ga0181555_100755463300020051Salt MarshMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ
Ga0211504_106960123300020347MarineMSIKISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQ
Ga0211505_113809533300020352MarineMSVEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQXV
Ga0211689_104171953300020358MarineMSKLKQTIIIENLDEYCEGNYFSDDVAVKYDLQNGKINTVAFCIDKQTATDMAKGLNLYDNIEEELG
Ga0211686_1012231653300020382MarineMEDRKVEITKENLEESCDGDYFSDDVAVKYDLRNGTINVVAYCICKNTAEGMANGLNLYNNLKEEL
Ga0211576_1066965223300020438MarineMNIDKKVITELSDGNYFSDETAVKYDLQNGKINVVAYCICKKTAEDMAKGLNLYDNVKEELDANIW
Ga0211577_1053388323300020469MarineMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIIEELD
Ga0213865_1009377543300021373SeawaterMTNIDINKDNIHELSDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDSIMEELDD
Ga0222717_1001686793300021957Estuarine WaterMSKLNQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELG
Ga0222717_1031896833300021957Estuarine WaterMKAITKNNIVIENFDEYCEGNYFSEDVAVKYDLQNGKINTIAFCICKKTAEDMAKSLNLYDNIEEELG
Ga0212024_100378183300022065AqueousMTNKIEITKENLEESCDGNYFSDDVAVKYDLQNGEINVVAYCICKNTANSMAKGLNLYNNLKEEL
Ga0212026_104661713300022069AqueousMMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ
Ga0196897_103556713300022158AqueousMSVEISKDNIDEMTEGNYFSEDTAIKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQXVWISKEI
Ga0196891_101906553300022183AqueousMSVEISKDNIDEMTEGNYFSEDTAIKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ
Ga0228669_101438863300024185SeawaterMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIMEELD
Ga0228629_104272613300024296SeawaterHTTKQYMKKKMRRSMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTATDMAKGLNLYDNIMEELD
Ga0228650_104564733300024417SeawaterMTNIDINKDNITEMTDGNYFADDTAVKFDRQNGRLSTVAFCIDKQTARDMAKGLNLYDNIMEELD
Ga0208669_1004232153300025099MarineMSIEISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQ
Ga0208159_103709433300025101MarineMTNIDINKNNITEMTDGNYFADSTAVKYDRQNGRLSTVAFCIDNQTARDMAKGLNLYDSIIEELDDXTNT
Ga0208013_107097633300025103MarineMSIKISKDNIDEMTDGNYFSEDTAVKYDLQNGTINTVAFCICKGTARDMAKGLNLYDNIIEELNQXV
Ga0209535_105195743300025120MarineMAKEILRYIQITKENLEESCEGNYFSEDVAVKYDLQNGTINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0209535_107293953300025120MarineMTNKIEITKENLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0209535_109584013300025120MarineMSKLKQTIIIENLDEYCEGNYFSDDVAVKFDLQNGKINTVAFCIDKQTAIDMAKGLNLYDNIEEELG
Ga0209634_102633293300025138MarineMTNKKDVLKYIQITKENLEESCDGNYFSDDVAVKYDLQNGEINVVAYCICKATANGMAKGLNLYNNLKEEL
Ga0209504_1028612103300025621Pelagic MarineMRNKTEITKKNLEEFCEGNYFSDDVAIKYDLQNGKINTVAFCICKKTAQDMAKALNLLDYIKEYD
Ga0208643_1002526203300025645AqueousMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTISFCICKGTARDTAKGLNLYDNIMEELG
Ga0208898_118396723300025671AqueousMSVEISKDNIDEMTEGNYFSEDTAVKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQXVWISKEI
Ga0209384_102646083300027522MarineMEDRKVEITKENLEESCDGDYFSDDVAVKYDLRNGTINVVAYCICKNTAEGMANGLNLYNNLKEEM
Ga0209384_104431723300027522MarineMENKIEITKENLEESCEGNYFSDDVAVKYDLKNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0209482_1015422113300027668MarineMENKIEITKKNLEESCEGNYFSDDVAVKYDLQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0209383_103870823300027672MarineMENKIEITKENLEESCEGNYFSDDVAVKYDLQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0209090_1013866213300027813MarineMTNKKDVLKYIQITRENLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKQTAKDMAKGLNLYDGLKEEL
Ga0183755_1009821133300029448MarineMTNIDINKNNITEMTDGNYFADSTAVKYDRQNSRLSTVAFCIDNQTARDMAKGLNLYDNIMEELDD
Ga0183755_101725043300029448MarineMKITKENYNELCEGNYWSDDVAVKYDLQNGQMNTVAFCICKKTAQDMAKALNLLDCISEE
Ga0308010_120834813300031510MarineMEDRKVEITKENLEESCDGDYFSDDVAVKYDLRNGTINVVAYCICKNTAEGMANGLN
Ga0307488_1049653323300031519Sackhole BrineMTNKKDVLKYIQITRENLEESCEGNYFSDDVAVKFDEQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0308014_102404483300031628MarineMENKIEITKENLKESCEGNYFSDDVAVKYDLQNGKINTVAFCICKKTAQDMAKGLNLYDGLKEEL
Ga0307984_101280513300031658MarineMENKIEITKENLEESCEGNYFSDDVAVKYDLQNGKINTVAFCICKKTAQDMAKGLNL
Ga0315320_1029932723300031851SeawaterMSIKISKDNIDEMTDGNYFSEDTAVKYDLQNGIINTVAFCICKGTARDIAKGLNLYDNIIEELD
Ga0348337_111972_574_8193300034418AqueousMHTTKQYMKKKMMRSMMSVEISKDNIDEMTEGNYFSEDTAIKYDLQNGTINTVAFCIDSQTARDMAKGLNLYDNIIEELNQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.