Basic Information | |
---|---|
Family ID | F097686 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 42 residues |
Representative Sequence | MATTVHEPPKIEPDRLPSQGSGNGGWRNLVPADGDLRRVKDH |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.03 % |
% of genes near scaffold ends (potentially truncated) | 99.04 % |
% of genes from short scaffolds (< 2000 bps) | 87.50 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.538 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (20.192 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 0.00% Coil/Unstructured: 95.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00115 | COX1 | 58.65 |
PF00116 | COX2 | 5.77 |
PF13620 | CarboxypepD_reg | 2.88 |
PF13442 | Cytochrome_CBB3 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 5.77 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 5.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.54 % |
All Organisms | root | All Organisms | 38.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908007|FWIRElOz_GKZ9IRQ01AIXUQ | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300001100|JGI12703J13194_103291 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300001175|JGI12649J13570_1009464 | Not Available | 1171 | Open in IMG/M |
3300001593|JGI12635J15846_10063294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2764 | Open in IMG/M |
3300001593|JGI12635J15846_10571890 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300001867|JGI12627J18819_10002777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6423 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100056325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3591 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100316651 | Not Available | 1443 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100832893 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101109951 | Not Available | 678 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10291874 | Not Available | 663 | Open in IMG/M |
3300004082|Ga0062384_100938982 | Not Available | 614 | Open in IMG/M |
3300004082|Ga0062384_101203535 | Not Available | 551 | Open in IMG/M |
3300004091|Ga0062387_100656715 | Not Available | 761 | Open in IMG/M |
3300004152|Ga0062386_100137093 | Not Available | 1902 | Open in IMG/M |
3300004152|Ga0062386_100504979 | Not Available | 982 | Open in IMG/M |
3300005538|Ga0070731_10513235 | Not Available | 798 | Open in IMG/M |
3300006176|Ga0070765_102285913 | Not Available | 504 | Open in IMG/M |
3300006755|Ga0079222_10791499 | Not Available | 772 | Open in IMG/M |
3300006800|Ga0066660_10257015 | Not Available | 1370 | Open in IMG/M |
3300006903|Ga0075426_10861480 | Not Available | 683 | Open in IMG/M |
3300009518|Ga0116128_1011992 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
3300009518|Ga0116128_1098987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300009552|Ga0116138_1200276 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300009628|Ga0116125_1264440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300009672|Ga0116215_1375213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300009698|Ga0116216_10373030 | Not Available | 867 | Open in IMG/M |
3300009759|Ga0116101_1077502 | Not Available | 749 | Open in IMG/M |
3300009762|Ga0116130_1001571 | All Organisms → cellular organisms → Bacteria | 12679 | Open in IMG/M |
3300010339|Ga0074046_10656087 | Not Available | 618 | Open in IMG/M |
3300010341|Ga0074045_10340120 | Not Available | 979 | Open in IMG/M |
3300011120|Ga0150983_16436275 | Not Available | 590 | Open in IMG/M |
3300011271|Ga0137393_10486684 | Not Available | 1058 | Open in IMG/M |
3300012208|Ga0137376_11061273 | Not Available | 693 | Open in IMG/M |
3300012923|Ga0137359_11591963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300014155|Ga0181524_10132403 | Not Available | 1324 | Open in IMG/M |
3300014169|Ga0181531_10162627 | Not Available | 1352 | Open in IMG/M |
3300014169|Ga0181531_10174357 | Not Available | 1303 | Open in IMG/M |
3300016341|Ga0182035_11213635 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300017924|Ga0187820_1082900 | Not Available | 904 | Open in IMG/M |
3300017936|Ga0187821_10463105 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300017940|Ga0187853_10021676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3557 | Open in IMG/M |
3300017942|Ga0187808_10357600 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300018006|Ga0187804_10507025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300018026|Ga0187857_10434112 | Not Available | 591 | Open in IMG/M |
3300018035|Ga0187875_10354814 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300018038|Ga0187855_10635648 | Not Available | 622 | Open in IMG/M |
3300018040|Ga0187862_10386147 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300018040|Ga0187862_10526549 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300018057|Ga0187858_10134031 | Not Available | 1662 | Open in IMG/M |
3300018090|Ga0187770_10567774 | Not Available | 900 | Open in IMG/M |
3300019188|Ga0184599_132279 | Not Available | 598 | Open in IMG/M |
3300019240|Ga0181510_1116500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300020580|Ga0210403_11336783 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300020581|Ga0210399_10249462 | Not Available | 1480 | Open in IMG/M |
3300020583|Ga0210401_10110135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2585 | Open in IMG/M |
3300021180|Ga0210396_11287966 | Not Available | 609 | Open in IMG/M |
3300021407|Ga0210383_10461867 | Not Available | 1096 | Open in IMG/M |
3300021474|Ga0210390_10275565 | Not Available | 1425 | Open in IMG/M |
3300021477|Ga0210398_11441035 | Not Available | 537 | Open in IMG/M |
3300021559|Ga0210409_10026745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5571 | Open in IMG/M |
3300021559|Ga0210409_10231547 | Not Available | 1676 | Open in IMG/M |
3300022521|Ga0224541_1007385 | Not Available | 1181 | Open in IMG/M |
3300022722|Ga0242657_1034977 | Not Available | 1035 | Open in IMG/M |
3300022722|Ga0242657_1203963 | Not Available | 548 | Open in IMG/M |
3300022726|Ga0242654_10284260 | Not Available | 603 | Open in IMG/M |
3300025404|Ga0208936_1022871 | Not Available | 810 | Open in IMG/M |
3300025414|Ga0208935_1031400 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300025434|Ga0208690_1058315 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300025917|Ga0207660_11436934 | Not Available | 558 | Open in IMG/M |
3300025932|Ga0207690_10084572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2224 | Open in IMG/M |
3300026469|Ga0257169_1055426 | Not Available | 629 | Open in IMG/M |
3300026482|Ga0257172_1103174 | Not Available | 524 | Open in IMG/M |
3300027064|Ga0208724_1020699 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027297|Ga0208241_1014500 | Not Available | 1137 | Open in IMG/M |
3300027439|Ga0209332_1001109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5888 | Open in IMG/M |
3300027575|Ga0209525_1086498 | Not Available | 747 | Open in IMG/M |
3300027605|Ga0209329_1074266 | Not Available | 735 | Open in IMG/M |
3300027629|Ga0209422_1025068 | Not Available | 1477 | Open in IMG/M |
3300027652|Ga0209007_1015882 | Not Available | 1959 | Open in IMG/M |
3300027660|Ga0209736_1068765 | Not Available | 985 | Open in IMG/M |
3300027692|Ga0209530_1135481 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300027692|Ga0209530_1135647 | Not Available | 692 | Open in IMG/M |
3300027829|Ga0209773_10380561 | Not Available | 587 | Open in IMG/M |
3300027879|Ga0209169_10024847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3207 | Open in IMG/M |
3300027889|Ga0209380_10147994 | Not Available | 1372 | Open in IMG/M |
3300028536|Ga0137415_10987072 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300028798|Ga0302222_10443343 | Not Available | 508 | Open in IMG/M |
3300028906|Ga0308309_10944077 | Not Available | 748 | Open in IMG/M |
3300029943|Ga0311340_10940869 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300029943|Ga0311340_11535102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300029951|Ga0311371_12650693 | Not Available | 504 | Open in IMG/M |
3300029992|Ga0302276_10239540 | Not Available | 815 | Open in IMG/M |
3300031708|Ga0310686_101979968 | Not Available | 915 | Open in IMG/M |
3300031708|Ga0310686_106903792 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031708|Ga0310686_118165056 | Not Available | 592 | Open in IMG/M |
3300031715|Ga0307476_10688751 | Not Available | 757 | Open in IMG/M |
3300031820|Ga0307473_10017020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2853 | Open in IMG/M |
3300031823|Ga0307478_11451927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300031837|Ga0302315_10471828 | Not Available | 686 | Open in IMG/M |
3300031891|Ga0316039_114942 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300032072|Ga0326631_116291 | Not Available | 532 | Open in IMG/M |
3300032898|Ga0335072_11555944 | Not Available | 561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 20.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.69% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRElOz_09706450 | 2124908007 | Soil | MATTVHEPPKVDLRRQRESGNGGWRNLVPADGDPRVVQD |
JGI12703J13194_1032911 | 3300001100 | Forest Soil | MATTVHEPPQIDPSRLPDRKHSGNGWKNIVPENGSSRVALDYS |
JGI12649J13570_10094641 | 3300001175 | Forest Soil | MATTVHEPPRIEPERLAGPGSGNGGGRDLVPNNGELRQVKDYSPP |
JGI12635J15846_100632941 | 3300001593 | Forest Soil | MATTVHEPPKNELDRLPSQGSGNGGWRNLVPADGDPR |
JGI12635J15846_105718902 | 3300001593 | Forest Soil | MATTVHEPPKIEPDRLPSQGSGNGGWRNLVPADGD |
JGI12627J18819_100027776 | 3300001867 | Forest Soil | MATTVHEPPKVEERRDQSRPARNSGNGWRNLVPSE |
JGIcombinedJ26739_1000563251 | 3300002245 | Forest Soil | MATTVHEPPKIEPRRQRDSGNGGWRNLVPAAEDRR |
JGIcombinedJ26739_1003166511 | 3300002245 | Forest Soil | MATTVHEPPKIEERRPGVSGNGGWRNLVPADGDPRVVQDYSPPPASTG |
JGIcombinedJ26739_1008328932 | 3300002245 | Forest Soil | MATTVHEPPKIEPHRLPYQRHSGNGGWRNLVPSDGDLRVALDY |
JGIcombinedJ26739_1011099512 | 3300002245 | Forest Soil | MASTVHEPPQIGERRSPDLKQSGNGGWRNLVPANGDLRVL |
JGIcombinedJ51221_102918742 | 3300003505 | Forest Soil | MATTIHEPPKIELDHLPSQGSGNGGGQNLAPTNGDLRRVKDSS |
Ga0062384_1009389822 | 3300004082 | Bog Forest Soil | MATTIPEPARIDPRRPDQRHTGNGGWRSLVPADGDLRVTEDYAPP |
Ga0062384_1012035351 | 3300004082 | Bog Forest Soil | MATTVHEPPKIDLNRLPSQGSGNGGWRNLVPTDGDLRQVKDSSP |
Ga0062387_1006567151 | 3300004091 | Bog Forest Soil | MATTVHEPPKIEIDRLPSQGSGNGGWRNLPADGDLRRVKDSSPPPAS |
Ga0062386_1001370931 | 3300004152 | Bog Forest Soil | MATTIPEPPKIELERPTSHGSGDGGWRNLPPGGELRRTKDNSPPPAS |
Ga0062386_1005049791 | 3300004152 | Bog Forest Soil | MATTIHEPPQIDPRRAPEPGHSGNGGWRNLVPAGGDLRVTLDYS |
Ga0070731_105132352 | 3300005538 | Surface Soil | MASTVHEPPQIDKQRLPDLKPSGNGGWRNLVPANG |
Ga0070765_1022859132 | 3300006176 | Soil | MATTVHEPPKIEPERLPSQGSGNGGWRNLGPADGDLRRVQSYSPP |
Ga0079222_107914991 | 3300006755 | Agricultural Soil | MATTIHEPPKIEPRPQRDNGNGGWRNLVPADGDRRMVQDYSPPPAST |
Ga0066660_102570151 | 3300006800 | Soil | MATTVHEPPQIDPNRLPERAHSGNGGGKNIVPAGGD |
Ga0075426_108614801 | 3300006903 | Populus Rhizosphere | MATTIHEPPKIEPRPQRDNGNGGWRNLVPADGDRRMVQD |
Ga0116128_10119924 | 3300009518 | Peatland | MATTVHEPPKIDLDRLPSQGSGNGGGRNPVPAGGD |
Ga0116128_10989871 | 3300009518 | Peatland | MATTVHEPPQIEPRRLPDEGHSGNGGGGNLVPAEGNL |
Ga0116222_12636001 | 3300009521 | Peatlands Soil | MATTVHEPPQIEPRRLPDDGRSGNGGERNLVPAEGNLR |
Ga0116138_12002761 | 3300009552 | Peatland | MATTIPEPPKIELDRLPSQGSGNGGRRNLGPAGGDLRRVQNSSPAP |
Ga0116125_12644401 | 3300009628 | Peatland | MATTTHEPPKIDLERLPSQGSGNGGWRNLVPADGDLRRVKNSS |
Ga0116215_13752132 | 3300009672 | Peatlands Soil | MATVHEPPQIDLRRLPEPGHSGNGGWRNMVPADGNLRVTLDYSP |
Ga0116216_103730302 | 3300009698 | Peatlands Soil | MGWEKFMATTVHEPPKIDERRDPSQLRIDSGKGGWR |
Ga0116101_10775021 | 3300009759 | Peatland | MATTVHEPPKIEPERVPSQGSGNGGWRNLAPADGALRRV |
Ga0116130_10015711 | 3300009762 | Peatland | MATTVHEPPKIDLDRLPSQGSGNGGGRNPVPAGGDLRRIKPSSPPPA |
Ga0074046_106560872 | 3300010339 | Bog Forest Soil | MATTIPEPPKIEFDRLPSQGSGNGGGRNLVPASGDLRRVKDSSPPPAS |
Ga0074045_103401202 | 3300010341 | Bog Forest Soil | MATTVHEPPKIDSHRLPDQRHSSNGDWRNLVPADGDLRVTQDY |
Ga0150983_164362751 | 3300011120 | Forest Soil | MATTVHEPPKIEGRRPSVSGNGGCRNLVPADGNPRAVQDYSPPPASTG |
Ga0137393_104866841 | 3300011271 | Vadose Zone Soil | MATTVHEPPKIEKERLQSQGSGNGGWRNLVSASGDLRRIKDPSPPPASTGI |
Ga0137376_110612732 | 3300012208 | Vadose Zone Soil | MATIIPEPPKIDPHRSPDQGHSGNGGWRNLVPGDGDLLVALEYSPP |
Ga0137359_115919632 | 3300012923 | Vadose Zone Soil | MATTVHEPPKIDPHRLPEQARSGNGGWRNLVPSDGELRVTQEYSP |
Ga0181524_101324032 | 3300014155 | Bog | MATTIHQPPQIDPRRLPDQGQSGDGGWRSLVPADGDLRVALD |
Ga0181531_101626271 | 3300014169 | Bog | MATTVHEPPKIDLDRVPSQGSGNGGWRNLGPAGGDLRRVKPSSPPPASTG |
Ga0181531_101743571 | 3300014169 | Bog | MATTVHEPPKVEQTKIDQTKIDKEKIGQERLPSQGSGNGGWRNLVPADGDLRRVKSYSPPPA |
Ga0182035_112136352 | 3300016341 | Soil | MATTVHEPPRIEEIRDPSRLRSSSDNGGWRNLVPSDG |
Ga0187820_10829001 | 3300017924 | Freshwater Sediment | MATTVHEPPKIEERRDPARLTSNSGNGGWRNLVPADGDV |
Ga0187821_104631051 | 3300017936 | Freshwater Sediment | MATTIQQPTKIAPERLPSQGSGNGGWRNLVPAGGDLRRVKNYSPP |
Ga0187853_100216761 | 3300017940 | Peatland | MATTVHEPPKIDLDRLPSQGSGNGGWRNLVPSGGD |
Ga0187808_103576001 | 3300017942 | Freshwater Sediment | MATTVHEPPQIDPRRLPEPKHSGNGGWRNLVPADGDLRVVQHY |
Ga0187804_105070252 | 3300018006 | Freshwater Sediment | MATTVHEPPKIEIDRLPSQGSGNGGWRNLVPAGGDLRRVKDSSPP |
Ga0187857_104341121 | 3300018026 | Peatland | MATTIPEPPKIELDRLPSQGSGNGGRRNLGPAGGDL |
Ga0187875_103548141 | 3300018035 | Peatland | MATTIHQPPQIDPRRLPDQGQSGNGGWRNLVPADGDL |
Ga0187855_106356481 | 3300018038 | Peatland | MATTVHEPPKIEPERLPSQGSGNGGWRNLVPTDGDLRRVKSYSPP |
Ga0187862_103861471 | 3300018040 | Peatland | MATTIHQPPQIDPRRLPDQGQSGNGGWRNLVPADGDLRVALDYSPPP |
Ga0187862_105265491 | 3300018040 | Peatland | MATTVPEPPKIDLERLPSDGSGKGGWGNLVPAGGELRRVK |
Ga0187858_101340312 | 3300018057 | Peatland | MATTIHQPPQIDPQSLLDQGRSGNGGWRNLVPADGDLRVALD |
Ga0187770_105677741 | 3300018090 | Tropical Peatland | MATTVHEPPKFEHDVVPSRGSGSGGWRNLAPADGDLRR |
Ga0184599_1322792 | 3300019188 | Soil | MATTVHEPPRIDPDRLPAKGHTGNGGRGNFVPADGDLHVT |
Ga0181510_11165002 | 3300019240 | Peatland | MATTVHEPPKIEPGPLPSHGSGDGGWRNLVPADGDLRQVRNASPPPAS |
Ga0210403_113367832 | 3300020580 | Soil | MATTIHEPPKIDLDRLPSQGSGNGGWRTLVPLDGDLRLAK |
Ga0210399_102494621 | 3300020581 | Soil | MATTVHEPPQIDRRRSPETSHSGNGGWRNLAPANGDLKAV |
Ga0210401_101101351 | 3300020583 | Soil | MATTIHEPPKIDLDRLPGHGSGNGGWRNLVPADGDVR |
Ga0210396_112879661 | 3300021180 | Soil | MASTVHEPPQIDKQRLPDLKQSGNGGWRNLVPANG |
Ga0210383_104618671 | 3300021407 | Soil | MATTIPEPPKIEQDRLPSQGSGGGWRNVVPASGDLR |
Ga0210390_102755651 | 3300021474 | Soil | MATTVHEPAKIDLERLPNQGAGNGGWRNLAPAGGDLRRVKDSSPPPA |
Ga0210398_114410351 | 3300021477 | Soil | MATTVHEPPKIDLDRLPSQGSGNGGWRNLVPPDGDLRQVKNSSPPP |
Ga0210409_100267456 | 3300021559 | Soil | MATTIHEPPKIDLDRLPGHGSGNGGWRNLVPSDGDVRLVKDS |
Ga0210409_102315471 | 3300021559 | Soil | MATTVHEPPRIDPDRLPEKGHTGNGGWGNFVPTDGDLRVTLE |
Ga0224541_10073851 | 3300022521 | Soil | MATTVHEPPKIEPRRLPIEGSGNGGWRNLVPAGGDPRRVKDSSPPPAS |
Ga0242657_10349771 | 3300022722 | Soil | MATTVHEPPKIEDRRDPWLKNSSGNGGGRNLVPADG |
Ga0242657_12039632 | 3300022722 | Soil | MATTVHEPPKIEERRPGVSGNGGWRNLVPADGDPRVVQDYSPPP |
Ga0242654_102842601 | 3300022726 | Soil | MATTVHEPPKTDPRRLPDQGRPGNGGWRNLVPADGDLRGTQEY |
Ga0208936_10228711 | 3300025404 | Peatland | MATTVHEPPKIDLDRLPSQGSGNGGGRNPVPAGGDLR |
Ga0208935_10314002 | 3300025414 | Peatland | MATTVHEPPKIDLDRLPSQGSGNGGWRNLVPAGGDLRRVKASSP |
Ga0208690_10583151 | 3300025434 | Peatland | MATTTHEPPKIDLERLPSQGSGNGGWRNLVPADGDLRR |
Ga0207660_114369342 | 3300025917 | Corn Rhizosphere | MATTIHEPPKIEPRPQRDNGNGGWRNLVPADGDRR |
Ga0207690_100845721 | 3300025932 | Corn Rhizosphere | MATTIHEPPTIEPRPQRDNGNGGWRNLVPADGDRRMVQDY |
Ga0257169_10554261 | 3300026469 | Soil | MATTVHEPPKIDPRRLPDQGHSGNGGWRNLVPADGDLRVTQEYSPPPSST |
Ga0257172_11031741 | 3300026482 | Soil | MATTLHEPPKIDPRRLPDQGHSGNGGWRNLAPADGDLRGT |
Ga0208724_10206991 | 3300027064 | Forest Soil | MATTVHEPPKIDLDRLPSQGSGNGGWRNLVPSDGDLRQV |
Ga0208241_10145001 | 3300027297 | Forest Soil | MATTVHEPPKIEIDRLPGQGSGNGGWRNPVSTDGDLRRVKDS |
Ga0209332_10011091 | 3300027439 | Forest Soil | MVTTIHEPPTIELDRLPSHGSHNGGWRNLVPADGDLRRVK |
Ga0209525_10864982 | 3300027575 | Forest Soil | MATTVHEPPKIEPERLPSQGSGNGGWRNLGPADGDLRRVQSYSPPPASTGV |
Ga0209329_10742662 | 3300027605 | Forest Soil | MATTVHEPPKIEPDRLPSQGSGNGGWRNLVPADGDLRRVKDH |
Ga0209422_10250682 | 3300027629 | Forest Soil | MATTVHEPPKIEPDRLPSQGSGNGGWRNLVPADGDLHRVKD |
Ga0209007_10158822 | 3300027652 | Forest Soil | MATTIQPPSQSESDRFPSQGSGHGGGRNLVPADGDMPSVKN |
Ga0209736_10687651 | 3300027660 | Forest Soil | MATTVHEPPQIDSHRLPETSHSGNGGWRNLVPADGDLRLAQHY |
Ga0209530_11354812 | 3300027692 | Forest Soil | MATTVHEPPKIERFPSHNSGNGGWRNLAPASGELRRVKDPSPAP |
Ga0209530_11356471 | 3300027692 | Forest Soil | MATTVHEPLKREIGRSLSQGSGNGGWRNLVPADGDVRRVKEYSPPPASTGIW |
Ga0209773_103805612 | 3300027829 | Bog Forest Soil | MGTTVHEPPKIDQRRGPDDAHSGNGGWRNLVPADGNLR |
Ga0209169_100248474 | 3300027879 | Soil | MATTVHEPVKREIGRSLRQGSGNGGWRNLVPADGDVRRVKEYSP |
Ga0209380_101479942 | 3300027889 | Soil | MATTVHEPPKIDLDRLPSQGSGNGGWRNLTPAGGDLR |
Ga0137415_109870721 | 3300028536 | Vadose Zone Soil | MATTVHEPPKIEPRRSPNEGSGNGGWRNLVPAGADARKLAD |
Ga0302222_104433431 | 3300028798 | Palsa | MATTVHEPPKIEPERVPSQGSGNGGWRNLAPADGALRRVQ |
Ga0308309_109440771 | 3300028906 | Soil | MATTVHEPPKIEIDRLPSHGSSNGGWHNLVPVDGDLRRVKDSSP |
Ga0311340_109408691 | 3300029943 | Palsa | MATTIHEPPTIDRERLPSQGSGNGGWRNLAPASGDLRRVKDSSPP |
Ga0311340_115351022 | 3300029943 | Palsa | MATTVHEPPQIDSDRLEDSGNGGWRNLIPANGDLRITADY |
Ga0311371_126506931 | 3300029951 | Palsa | MATTVHEPPKIEPERVPSQGSGNGGWRNLAPADGALRRVQSYS |
Ga0302276_102395402 | 3300029992 | Bog | MATTVHEPPIEQTKIEQERSLSQGSGNGGWRNLAPAGGDMRRVKD |
Ga0310686_1019799682 | 3300031708 | Soil | MATTINEPPQIDPDRLPDHGHAGKGGWGNLVPVDGDLRVTQ |
Ga0310686_1069037922 | 3300031708 | Soil | MATTVHEPPRIEEPRDPRLGGTSGNGGRNLVPANG |
Ga0310686_1181650562 | 3300031708 | Soil | MATTVQQPPTIEQDRLPSQGSGNGGWRNLAPGGGDQRRVKDSSPPPASTG |
Ga0307476_106887512 | 3300031715 | Hardwood Forest Soil | MATTIQQPPKIEHEHLPSQGSGNGGWRNLVPAGRDPRKVKSFSPPPAS |
Ga0307473_100170203 | 3300031820 | Hardwood Forest Soil | MATTVHEPPKIEKIREPRSGSGNGGWRNLVPAGELRSVQEYAPPPA |
Ga0307478_114519272 | 3300031823 | Hardwood Forest Soil | MATTVHEPPKIDLELLPSQGSGGGGWGTMVPAGGDLRRVKNS |
Ga0302315_104718281 | 3300031837 | Palsa | MATTVHEPPKIEPRRLPIEGSGNGGWRNLVPAGGDPRRVKDSSPP |
Ga0316039_1149422 | 3300031891 | Soil | MATTVHEPPKIDLDRSPSQGSGNGGSRNLVPAGGDLRRVKDY |
Ga0326631_1162912 | 3300032072 | Soil | MATTIHEPPKIELDRLPSHGNGDWRNLPPANGDLRRIKDSS |
Ga0335072_115559441 | 3300032898 | Soil | MATTVHEPPKIETDRLPSQGSGDGGWRNLVPADGDLR |
⦗Top⦘ |