NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097864

Metagenome / Metatranscriptome Family F097864

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097864
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 38 residues
Representative Sequence TPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA
Number of Associated Samples 87
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.077 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(39.423 % of family members)
Environment Ontology (ENVO) Unclassified
(45.192 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.115 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.15%    Coil/Unstructured: 84.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13690CheX 18.27
PF01557FAA_hydrolase 5.77
PF00072Response_reg 4.81
PF01339CheB_methylest 2.88
PF03795YCII 1.92
PF01156IU_nuc_hydro 1.92
PF04509CheC 1.92
PF01039Carboxyl_trans 1.92
PF05593RHS_repeat 0.96
PF00682HMGL-like 0.96
PF01209Ubie_methyltran 0.96
PF00011HSP20 0.96
PF01494FAD_binding_3 0.96
PF02371Transposase_20 0.96
PF03992ABM 0.96
PF03255ACCA 0.96
PF01344Kelch_1 0.96
PF00069Pkinase 0.96
PF07883Cupin_2 0.96
PF01584CheW 0.96
PF01797Y1_Tnp 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 5.77
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.85
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 2.88
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.92
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 1.92
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 1.92
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.92
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 1.92
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.96
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.96
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.96
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.96
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.96
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.96
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.96
COG3209Uncharacterized conserved protein RhaS, contains 28 RHS repeatsGeneral function prediction only [R] 0.96
COG3547TransposaseMobilome: prophages, transposons [X] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101436659All Organisms → cellular organisms → Bacteria → Acidobacteria1237Open in IMG/M
3300000559|F14TC_103090663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300001162|JGI12714J13572_1009400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300002245|JGIcombinedJ26739_100776330All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300002917|JGI25616J43925_10012803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3699Open in IMG/M
3300004092|Ga0062389_104528655All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005172|Ga0066683_10000696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter11639Open in IMG/M
3300005330|Ga0070690_100991318All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005526|Ga0073909_10726435All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005537|Ga0070730_10388673All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300005537|Ga0070730_10424256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter859Open in IMG/M
3300005552|Ga0066701_10176225All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300005598|Ga0066706_10617211All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300006046|Ga0066652_101023210All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300006173|Ga0070716_101774286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300006176|Ga0070765_100967649All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300006755|Ga0079222_10444802All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300006797|Ga0066659_10317049All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300006954|Ga0079219_10308473All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300007258|Ga0099793_10276082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300007265|Ga0099794_10736736All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300009088|Ga0099830_11098207All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009088|Ga0099830_11396055All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300009137|Ga0066709_103733940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300009545|Ga0105237_11478372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300009824|Ga0116219_10393156All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300010043|Ga0126380_10511375All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300010048|Ga0126373_12641437All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300010159|Ga0099796_10047059All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300010322|Ga0134084_10092658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300010366|Ga0126379_12616245All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010398|Ga0126383_10471724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1308Open in IMG/M
3300010398|Ga0126383_13129211All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300011269|Ga0137392_11090913All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300011270|Ga0137391_10349447All Organisms → cellular organisms → Bacteria → Acidobacteria1270Open in IMG/M
3300011270|Ga0137391_11236929All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300011271|Ga0137393_10172379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1816Open in IMG/M
3300011271|Ga0137393_10735574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter844Open in IMG/M
3300011271|Ga0137393_11129420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300011271|Ga0137393_11470963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300012096|Ga0137389_10447060All Organisms → cellular organisms → Bacteria → Acidobacteria1106Open in IMG/M
3300012189|Ga0137388_10879481All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300012189|Ga0137388_11904980All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012202|Ga0137363_10058444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2791Open in IMG/M
3300012203|Ga0137399_10222169All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300012203|Ga0137399_11416510All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300012205|Ga0137362_10307037Not Available1374Open in IMG/M
3300012205|Ga0137362_10772775All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300012205|Ga0137362_11793602All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012206|Ga0137380_10686847All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300012206|Ga0137380_11001907Not Available714Open in IMG/M
3300012207|Ga0137381_10061591All Organisms → cellular organisms → Bacteria3118Open in IMG/M
3300012207|Ga0137381_10733459All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300012208|Ga0137376_10536285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1014Open in IMG/M
3300012209|Ga0137379_10251653All Organisms → cellular organisms → Bacteria → Acidobacteria1680Open in IMG/M
3300012210|Ga0137378_11734922All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012351|Ga0137386_10873599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.645Open in IMG/M
3300012357|Ga0137384_10011462All Organisms → cellular organisms → Bacteria → Acidobacteria7202Open in IMG/M
3300012359|Ga0137385_10377363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1211Open in IMG/M
3300012361|Ga0137360_10196495All Organisms → cellular organisms → Bacteria → Acidobacteria1630Open in IMG/M
3300012361|Ga0137360_10220820All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300012683|Ga0137398_10070275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2132Open in IMG/M
3300012683|Ga0137398_10714121All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012685|Ga0137397_11005053All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300012918|Ga0137396_10699736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300012923|Ga0137359_10246880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1592Open in IMG/M
3300012923|Ga0137359_10570599All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300012924|Ga0137413_10771190All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300012976|Ga0134076_10475999All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300013308|Ga0157375_12410686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300015356|Ga0134073_10008888All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300015358|Ga0134089_10321842All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300018060|Ga0187765_11022819All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300020034|Ga0193753_10059177All Organisms → cellular organisms → Bacteria → Acidobacteria2023Open in IMG/M
3300020581|Ga0210399_10295380All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300021178|Ga0210408_10955036All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300021432|Ga0210384_11176143All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300021560|Ga0126371_11147655All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300022532|Ga0242655_10063929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis938Open in IMG/M
3300025906|Ga0207699_10173885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1443Open in IMG/M
3300025915|Ga0207693_10570755All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300025941|Ga0207711_11250560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300025961|Ga0207712_11142468All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300026309|Ga0209055_1139197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300026333|Ga0209158_1219556All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300026374|Ga0257146_1036182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300026532|Ga0209160_1272084All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027587|Ga0209220_1176811All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300027825|Ga0209039_10295763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300027826|Ga0209060_10426964All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300027875|Ga0209283_10584702All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300031740|Ga0307468_101691481All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031823|Ga0307478_10402529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1134Open in IMG/M
3300031859|Ga0318527_10457039All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300031962|Ga0307479_10726660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191971Open in IMG/M
3300032055|Ga0318575_10659902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300032180|Ga0307471_100011096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6073Open in IMG/M
3300032180|Ga0307471_103175941All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300032829|Ga0335070_10017354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8349Open in IMG/M
3300033289|Ga0310914_10312003All Organisms → cellular organisms → Bacteria → Acidobacteria1419Open in IMG/M
3300033290|Ga0318519_10561133All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300033402|Ga0326728_11003240All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300033480|Ga0316620_10523617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1100Open in IMG/M
3300034125|Ga0370484_0177881All Organisms → cellular organisms → Bacteria578Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil39.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001162Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10143665913300000364SoilPGSSAIFVPIRIVFSQSIPSAGLFRHGAAYLKPPE*
F14TC_10309066323300000559SoilTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE*
JGI12714J13572_100940013300001162Forest SoilPGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI*
JGIcombinedJ26739_10077633013300002245Forest SoilSAAIFVPIRIVFSQAITSAGLYRHGAAYLRPPNEAGI*
JGI25616J43925_1001280353300002917Grasslands SoilPFTPGAGAIFVPIRIVFSQAIASAGLFRHGAAYIKPPVDGAD*
Ga0062389_10452865523300004092Bog Forest SoilVPFTPGSSAIFVPIRIVFSQPIVSAGLFRHGAAYIKPPIDFGG*
Ga0066683_1000069613300005172SoilPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPSDN*
Ga0070690_10099131813300005330Switchgrass RhizosphereFTPGSAAIFVPIRVVFSQAIPTAGLYRHGAAYIKIPVDGGA*
Ga0073909_1072643513300005526Surface SoilYTPGTGAIFVPIRIVFSQHIPSAGLYRHGAAYLRPPD*
Ga0070730_1038867333300005537Surface SoilPGAGAIFVPIRIVFSQPIPSAGLFRHGAAYIKPPE*
Ga0070730_1042425633300005537Surface SoilIFVPIRIVFSQALPNIGLYRHGAAYVKPPVDGGA*
Ga0066701_1017622513300005552SoilTGAIFVPIRIVFSQAMPTAGLYRHGAAYIKPPLDT*
Ga0066706_1061721113300005598SoilVEVAVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDK*
Ga0066652_10102321013300006046SoilVAVPFTPGSGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI*
Ga0070716_10177428623300006173Corn, Switchgrass And Miscanthus RhizosphereFTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPG*
Ga0070765_10096764913300006176SoilSGAIFVPIRIVFSQAIPSVGLYRHGAAYIRPASDSAD*
Ga0079222_1044480223300006755Agricultural SoilTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN*
Ga0066659_1031704943300006797SoilPFTPGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI*
Ga0079219_1030847313300006954Agricultural SoilGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPMDN*
Ga0099793_1027608223300007258Vadose Zone SoilTPGSGAIFVPIRIVFSQAIPTAGLYRHGAAYVKPPLDI*
Ga0099794_1073673623300007265Vadose Zone SoilTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGA*
Ga0099830_1109820713300009088Vadose Zone SoilVLSTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGV*
Ga0099830_1139605523300009088Vadose Zone SoilAGAIFVPIRIVFSQGLPAVGLYRHGAAYVKPPTDGA*
Ga0066709_10373394023300009137Grasslands SoilPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV*
Ga0105237_1147837223300009545Corn RhizosphereGSSAIFVPIRIVFSQSIPSAGLFRHGAAYLKPPE*
Ga0116219_1039315613300009824Peatlands SoilPGAGAIFVPIRIVFSQPIAKAGLFRHGAAYVRTPE*
Ga0126380_1051137523300010043Tropical Forest SoilPGTGAIFVPIRIVFSTPIASAGLFRHGAAYLRPPE*
Ga0126373_1264143723300010048Tropical Forest SoilYTPGAGAIFVPIRIVFSQPISTAGLFRHGAEYLRPPD*
Ga0099796_1004705913300010159Vadose Zone SoilPFTPGAGAIFVPIRIVFSEPIRSAGLFRHGAAYLKPPE*
Ga0134084_1009265813300010322Grasslands SoilGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI*
Ga0126379_1261624523300010366Tropical Forest SoilGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPIDN*
Ga0126383_1047172413300010398Tropical Forest SoilVPFTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE*
Ga0126383_1312921113300010398Tropical Forest SoilVPYTAGTGTIFVPIRIIFSQDIPAAGLYRHGAAYIKPAFNT*
Ga0137392_1109091313300011269Vadose Zone SoilTPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDS*
Ga0137391_1034944713300011270Vadose Zone SoilTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA*
Ga0137391_1123692923300011270Vadose Zone SoilGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGA*
Ga0137393_1017237913300011271Vadose Zone SoilPGSGNIFVPVRIVFSQQIPAAGLYRHGASYIQQTSDRPE*
Ga0137393_1073557413300011271Vadose Zone SoilPFTPGAGAIFVPIRIVFSQPIPSAGLFRHGAAYIKPPVDAGD*
Ga0137393_1112942023300011271Vadose Zone SoilPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN*
Ga0137393_1147096313300011271Vadose Zone SoilGAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDA*
Ga0137389_1044706023300012096Vadose Zone SoilPGTGAIFVPIRIVFSQAIPAVGLYRHGAAYIKPPLDA*
Ga0137388_1087948113300012189Vadose Zone SoilTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN*
Ga0137388_1190498023300012189Vadose Zone SoilGAIFVPIRIVFSQPIAAAGLFRHGAAYIKPPIDAGG*
Ga0137363_1005844413300012202Vadose Zone SoilGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPGDGA*
Ga0137399_1022216943300012203Vadose Zone SoilAIFVPIRIVFSQAIPSAGLFRHGAAYIRPPVDGAD*
Ga0137399_1141651013300012203Vadose Zone SoilTPGSGAIFVPIRIVFSQAIPSAGLYRHGAAYLRAPE*
Ga0137362_1030703713300012205Vadose Zone SoilTPGSGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPLDT*
Ga0137362_1077277513300012205Vadose Zone SoilTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPRDA*
Ga0137362_1179360223300012205Vadose Zone SoilFTPGAGAIFVPIRIVFSQALPTVGLYRHGAAYVKPPMDGV*
Ga0137380_1068684723300012206Vadose Zone SoilTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPMDN*
Ga0137380_1100190713300012206Vadose Zone SoilTPGNSAIFVPIRIVSSRPIPTAGLFRHGAAYVSAPSD*
Ga0137381_1006159113300012207Vadose Zone SoilFTPGTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDA*
Ga0137381_1073345923300012207Vadose Zone SoilAVPFTPGSGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDT*
Ga0137376_1053628533300012208Vadose Zone SoilAVPFTPGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI*
Ga0137379_1025165313300012209Vadose Zone SoilGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDV*
Ga0137378_1173492213300012210Vadose Zone SoilNIFVPVRIVFSQQIPAAGLYRHGAAYIRLAPSDSE*
Ga0137386_1087359923300012351Vadose Zone SoilGTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDV*
Ga0137384_1001146213300012357Vadose Zone SoilEVAVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPLDA*
Ga0137385_1037736313300012359Vadose Zone SoilGTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDA*
Ga0137360_1019649533300012361Vadose Zone SoilTPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA*
Ga0137360_1022082033300012361Vadose Zone SoilPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDG*
Ga0137398_1007027533300012683Vadose Zone SoilGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA*
Ga0137398_1071412113300012683Vadose Zone SoilAVPFTPGAGAIFVPIRIVFSQGLPAVGLYRHGAAYVKPPMDGA*
Ga0137397_1100505323300012685Vadose Zone SoilFTPGAGAIFVPIRIVFSQGLPAVGLYRLGAAYVKPPMDGA*
Ga0137396_1069973623300012918Vadose Zone SoilTGAIFVPIRIVFSQSIPTAGLYRHGASYIKPPLDL*
Ga0137359_1024688013300012923Vadose Zone SoilTPGSGAIFVPIRIVFSQAIPTAGLHRHGAAYVKPPLDA*
Ga0137359_1057059933300012923Vadose Zone SoilVPFTPGSGAIFVPIRIVFSQPIPSAGLFRHGAAYLKPPE*
Ga0137413_1077119013300012924Vadose Zone SoilPGAGAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDV*
Ga0134076_1047599923300012976Grasslands SoilPFTPGSGAIFVPIRIVFSQPIPSAGLFRHGAAYLKPPE*
Ga0157375_1241068623300013308Miscanthus RhizosphereGNSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPV*
Ga0134073_1000888833300015356Grasslands SoilVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDK*
Ga0134089_1032184223300015358Grasslands SoilPGTGAIFVPIRIVFSQAMPTAGLYRHGAAYIKPPLDT*
Ga0187765_1102281923300018060Tropical PeatlandTPGSAAIFVPIRIVFSQAIAAAGLFRHGAAYIRPPGEGGD
Ga0193753_1005917713300020034SoilTPGSGAIFVPIRIVFSQAIPSAGLYRHGAAYLRPGIEPGS
Ga0210399_1029538043300020581SoilTPGSSAIFVPIRIVFSQAISSAGLYRHGAAYIRTAVDSGD
Ga0210408_1095503633300021178SoilVPFTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPTEGA
Ga0210384_1117614333300021432SoilTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPTEGA
Ga0126371_1114765523300021560Tropical Forest SoilVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYVKPPIDN
Ga0242655_1006392933300022532SoilAVPFTPGSSAIFVPIRIVFSQPIPSAGLFRHGAAYIRTPVAAGD
Ga0207699_1017388513300025906Corn, Switchgrass And Miscanthus RhizosphereTPGSGAIFVPVRIVFSVALPSAGLFKHGAAYVKALSGAGA
Ga0207693_1057075513300025915Corn, Switchgrass And Miscanthus RhizosphereAVPFTPGAGAIFVPIRIVFSQPIRSAGLFRHGAAYLKPPE
Ga0207711_1125056023300025941Switchgrass RhizosphereVPFTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE
Ga0207712_1114246823300025961Switchgrass RhizosphereAIFVPIRVVFSQAIPTAGLYRHGAAYIKIPVDGGA
Ga0209055_113919713300026309SoilFTPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV
Ga0209158_121955623300026333SoilPGSGNIFVPVRIVFSQQIPAAGLYRHGAAYIRLAPSDSE
Ga0257146_103618213300026374SoilGSGAIFVPIRIVFSQAIPTAGLYRHGAAYVKPPLDA
Ga0209160_127208423300026532SoilTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV
Ga0209220_117681123300027587Forest SoilTGAIFVPIRIVFSQAIPTAGLYRHGASYIKPPLDA
Ga0209039_1029576313300027825Bog Forest SoilVPYTPGAGAIFVPIRIVSCQPIATAGLFRHGAAYVRTME
Ga0209060_1042696413300027826Surface SoilGSAAIFVPIRIVFSQAIPSAGLYRHGAAYLRPPNEAGA
Ga0209283_1058470213300027875Vadose Zone SoilGTGAIFVPIRIVFSQAIPAVGLYRHGAAYIKPPLDA
Ga0307468_10169148113300031740Hardwood Forest SoilPGAGAIFVPIRIVFSQALPNVGLYRHGAAYVKANVDGGA
Ga0307478_1040252933300031823Hardwood Forest SoilPFTPGSSAIFVPIRIVFSQPIPSAGLFRHGASYLKPPE
Ga0318527_1045703913300031859SoilYTPGAGSIFVPIRIVFSQPISTAGLFRHGAAYLRPPD
Ga0307479_1072666013300031962Hardwood Forest SoilTPGTGAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDA
Ga0318575_1065990213300032055SoilPGTGAIFVPIRIVFSQAIPTVGLHRHGAAYIKPPIDN
Ga0307471_10001109613300032180Hardwood Forest SoilTPGSAAIFVPIRIVFSQAIPAAGLYRHGAAYIRPPVDSGA
Ga0307471_10317594113300032180Hardwood Forest SoilAGAIFVPIRIVFSQAIPSAGLFRHGAAYIRPPVDAGD
Ga0335070_1001735413300032829SoilYTPGAGAIFVPIRIVFSQPIAAGLFRHGAAYLRPPE
Ga0310914_1031200313300033289SoilAVPFTPGAGAIFVPIRIVFSQPIASAGLFRHGASYLRPPE
Ga0318519_1056113313300033290SoilVPYTPGAGAIFVPIRIVFSQPISTAGLFRHGASYLRPPE
Ga0326728_1100324013300033402Peat SoilPGAGAIFVPIRIVFSQPIATAGLFRHGAAYVRPPE
Ga0316620_1052361713300033480SoilSGAIFVPIRIVFSQAIASAGLYRHGAAYIRPPMDSAD
Ga0370484_0177881_38_1813300034125Untreated Peat SoilVEVAVPFTPGSSAIFVPIRIVFSVPLPSAGLFKHGAAYIKSPNESGV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.