Metagenome Family F097888

Basic Information
Family ID	F097888
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	37 residues
Representative Sequence	AVTVLLARLFLKEHFTRWRFVGLLAALAAVPMIAAG
Number of Associated Samples	96
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	86.54 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Bacteria (58.654 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.692 % of family members)
Environment Ontology (ENVO)	Unclassified (25.962 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (54.808 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00005	ABC_tran	59.62
PF08352	oligo_HPY	7.69
PF04893	Yip1	2.88
PF00892	EamA	1.92
PF01738	DLH	1.92
PF01266	DAO	1.92
PF06155	GBBH-like_N	1.92
PF08843	AbiEii	0.96
PF13847	Methyltransf_31	0.96
PF08281	Sigma70_r4_2	0.96
PF13646	HEAT_2	0.96
PF14031	D-ser_dehydrat	0.96
PF03916	NrfD	0.96
PF03721	UDPG_MGDP_dh_N	0.96
PF06930	Obsolete Pfam Family	0.96
PF02517	Rce1-like	0.96
PF13520	AA_permease_2	0.96
PF06386	GvpL_GvpF	0.96
PF10431	ClpB_D2-small	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG3536	Uncharacterized conserved protein, DUF971 family	Function unknown [S]	1.92
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.96
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.96
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.96
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.96
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.96
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	0.96
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.65 %
Unclassified	root	N/A	41.35 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.65 %
Unclassified	root	N/A	41.35 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.65 %
Unclassified	root	N/A	41.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	25.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.77 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	15.38 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	7.69 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.88 %
unclassified Terrabacteria group	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group	0.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	15.38 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.92 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	14.42 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.96 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.96 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.96 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	5.77 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	0.96 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.96 %
unclassified Myxococcales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales	0.96 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4.81 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.96 %
Mesorhizobium amorphae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae	0.96 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.96 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4.81 %
Mesorhizobium amorphae CCBAU 01583	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae → Mesorhizobium amorphae CCBAU 01583	0.96 %
unclassified Streptomyces	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces	0.96 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.96 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.35 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.69 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4.81 %
Streptomyces sp. ERV7	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ERV7	0.96 %
Mesorhizobium amorphae CCBAU 01583	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae → Mesorhizobium amorphae CCBAU 01583	0.96 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.96 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	0.96 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2189573001\|GZR05M102IXH1K	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300001100\|JGI12703J13194_104166	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300001356\|JGI12269J14319_10068484	All Organisms → cellular organisms → Bacteria	1970	Open in IMG/M
3300005532\|Ga0070739_10343622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	706	Open in IMG/M
3300005577\|Ga0068857_100007990	All Organisms → cellular organisms → Bacteria	9131	Open in IMG/M
3300005591\|Ga0070761_10970843	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300005602\|Ga0070762_10266559	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300005610\|Ga0070763_10156303	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1194	Open in IMG/M
3300005610\|Ga0070763_10172172	All Organisms → cellular organisms → Bacteria	1142	Open in IMG/M
3300005616\|Ga0068852_102390593	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300005764\|Ga0066903_101299977	All Organisms → cellular organisms → Bacteria	1359	Open in IMG/M
3300005829\|Ga0074479_10931834	All Organisms → cellular organisms → Bacteria	1792	Open in IMG/M
3300005995\|Ga0066790_10308097	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	675	Open in IMG/M
3300005995\|Ga0066790_10494030	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300006050\|Ga0075028_100862152	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300006052\|Ga0075029_101259795	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300006173\|Ga0070716_101077288	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300006176\|Ga0070765_102113340	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300009143\|Ga0099792_10694443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	658	Open in IMG/M
3300009616\|Ga0116111_1173331	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300009635\|Ga0116117_1211654	Not Available	515	Open in IMG/M
3300009643\|Ga0116110_1061999	All Organisms → cellular organisms → Bacteria	1320	Open in IMG/M
3300009644\|Ga0116121_1128639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae → Mesorhizobium amorphae CCBAU 01583	797	Open in IMG/M
3300009683\|Ga0116224_10475796	Not Available	595	Open in IMG/M
3300009698\|Ga0116216_10782075	Not Available	572	Open in IMG/M
3300009759\|Ga0116101_1036428	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023	Open in IMG/M
3300009764\|Ga0116134_1038344	All Organisms → cellular organisms → Bacteria	1870	Open in IMG/M
3300010048\|Ga0126373_10249392	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1746	Open in IMG/M
3300010335\|Ga0134063_10591195	Not Available	564	Open in IMG/M
3300010336\|Ga0134071_10720285	Not Available	529	Open in IMG/M
3300010339\|Ga0074046_10047779	All Organisms → cellular organisms → Bacteria	2853	Open in IMG/M
3300010339\|Ga0074046_10435112	Not Available	789	Open in IMG/M
3300010341\|Ga0074045_11053353	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509	Open in IMG/M
3300010343\|Ga0074044_10375279	Not Available	932	Open in IMG/M
3300010343\|Ga0074044_10898601	Not Available	579	Open in IMG/M
3300010359\|Ga0126376_10026719	All Organisms → cellular organisms → Bacteria	3850	Open in IMG/M
3300010361\|Ga0126378_13183133	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522	Open in IMG/M
3300010376\|Ga0126381_101532730	Not Available	963	Open in IMG/M
3300011271\|Ga0137393_10003584	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	10097	Open in IMG/M
3300012203\|Ga0137399_11511490	Not Available	559	Open in IMG/M
3300012207\|Ga0137381_10187845	All Organisms → cellular organisms → Bacteria	1788	Open in IMG/M
3300012211\|Ga0137377_10681924	Not Available	963	Open in IMG/M
3300012349\|Ga0137387_10881446	Not Available	647	Open in IMG/M
3300012351\|Ga0137386_10569213	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ERV7	816	Open in IMG/M
3300012582\|Ga0137358_10877417	Not Available	590	Open in IMG/M
3300014164\|Ga0181532_10251892	Not Available	1014	Open in IMG/M
3300014489\|Ga0182018_10751738	Not Available	507	Open in IMG/M
3300014490\|Ga0182010_10013687	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	3663	Open in IMG/M
3300014491\|Ga0182014_10488014	Not Available	605	Open in IMG/M
3300014501\|Ga0182024_11484351	Not Available	775	Open in IMG/M
3300014654\|Ga0181525_10542784	Not Available	645	Open in IMG/M
3300017940\|Ga0187853_10222543	Not Available	875	Open in IMG/M
3300017955\|Ga0187817_10849200	Not Available	583	Open in IMG/M
3300017972\|Ga0187781_11095443	Not Available	584	Open in IMG/M
3300017975\|Ga0187782_10160707	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1674	Open in IMG/M
3300018008\|Ga0187888_1251951	Not Available	687	Open in IMG/M
3300018012\|Ga0187810_10406548	Not Available	573	Open in IMG/M
3300018026\|Ga0187857_10024487	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3324	Open in IMG/M
3300018034\|Ga0187863_10026458	All Organisms → cellular organisms → Bacteria → Acidobacteria	3477	Open in IMG/M
3300018085\|Ga0187772_10055761	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2442	Open in IMG/M
3300018086\|Ga0187769_10168451	All Organisms → cellular organisms → Bacteria → Acidobacteria	1611	Open in IMG/M
3300018090\|Ga0187770_10014835	All Organisms → cellular organisms → Bacteria	5118	Open in IMG/M
3300018090\|Ga0187770_10738738	All Organisms → cellular organisms → Bacteria	786	Open in IMG/M
3300019786\|Ga0182025_1060744	Not Available	814	Open in IMG/M
3300020580\|Ga0210403_10536819	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	948	Open in IMG/M
3300021168\|Ga0210406_10191796	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1698	Open in IMG/M
3300021402\|Ga0210385_10603975	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	837	Open in IMG/M
3300021559\|Ga0210409_10928018	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	744	Open in IMG/M
3300023056\|Ga0233357_1059281	Not Available	501	Open in IMG/M
3300023101\|Ga0224557_1133943	All Organisms → cellular organisms → Bacteria	941	Open in IMG/M
3300027545\|Ga0209008_1002161	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4749	Open in IMG/M
3300027562\|Ga0209735_1003402	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2847	Open in IMG/M
3300027609\|Ga0209221_1040190	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1245	Open in IMG/M
3300027662\|Ga0208565_1038311	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1593	Open in IMG/M
3300027674\|Ga0209118_1080409	Not Available	933	Open in IMG/M
3300027884\|Ga0209275_10673525	Not Available	595	Open in IMG/M
3300027908\|Ga0209006_10974537	Not Available	676	Open in IMG/M
3300027911\|Ga0209698_10226064	Not Available	1503	Open in IMG/M
3300027915\|Ga0209069_10948493	Not Available	524	Open in IMG/M
3300027986\|Ga0209168_10093873	All Organisms → cellular organisms → Bacteria → Proteobacteria	1552	Open in IMG/M
3300028795\|Ga0302227_10380056	Not Available	536	Open in IMG/M
3300029915\|Ga0311358_10208656	All Organisms → cellular organisms → Bacteria → Proteobacteria	1764	Open in IMG/M
3300029954\|Ga0311331_10699693	All Organisms → cellular organisms → Bacteria	935	Open in IMG/M
3300029981\|Ga0302293_10103475	Not Available	929	Open in IMG/M
3300030707\|Ga0310038_10499476	Not Available	514	Open in IMG/M
3300031241\|Ga0265325_10165139	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1039	Open in IMG/M
3300031250\|Ga0265331_10392622	Not Available	622	Open in IMG/M
3300031524\|Ga0302320_12132564	Not Available	520	Open in IMG/M
3300031715\|Ga0307476_11184920	Not Available	559	Open in IMG/M
3300031716\|Ga0310813_11295852	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300031718\|Ga0307474_11518486	Not Available	527	Open in IMG/M
3300031754\|Ga0307475_10592927	Not Available	887	Open in IMG/M
3300031754\|Ga0307475_11190388	All Organisms → cellular organisms → Bacteria → Proteobacteria	594	Open in IMG/M
3300031823\|Ga0307478_10526305	Not Available	986	Open in IMG/M
3300031896\|Ga0318551_10171932	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	1190	Open in IMG/M
3300031912\|Ga0306921_10040158	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5278	Open in IMG/M
3300031912\|Ga0306921_10542825	Not Available	1349	Open in IMG/M
3300032059\|Ga0318533_11350156	Not Available	521	Open in IMG/M
3300032160\|Ga0311301_10222121	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3182	Open in IMG/M
3300032180\|Ga0307471_101869203	Not Available	750	Open in IMG/M
3300032828\|Ga0335080_10667942	All Organisms → cellular organisms → Bacteria	1086	Open in IMG/M
3300033158\|Ga0335077_10435505	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1401	Open in IMG/M
3300033158\|Ga0335077_11205613	Not Available	741	Open in IMG/M
3300033412\|Ga0310810_10006638	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	13102	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.15%
Host-Associated	Host-Associated	3.85%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.88%
Aquatic	Environmental → Aquatic	18.27%
Plants	Host-Associated → Plants	3.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	72.12%
Freshwater	Environmental → Aquatic → Freshwater	13.46%
Peat	Environmental → Terrestrial → Peat	5.77%
Sediment	Environmental → Aquatic → Sediment	4.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.46%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	20.19%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	13.46%
Loam	Environmental → Terrestrial → Soil → Loam	13.46%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	5.77%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.81%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.92%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.04%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.42%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	13.46%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.50%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	6.73%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	5.77%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	5.77%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	5.77%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.81%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.96%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.73%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	5.77%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	5.77%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.77%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	5.77%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	4.81%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	3.85%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.88%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	2.88%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.92%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.92%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.92%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.92%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.96%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.96%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.96%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.96%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.96%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.96%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2189573001	Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)	Environmental	Open in IMG/M
3300001100	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1	Environmental	Open in IMG/M
3300001356	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007	Environmental	Open in IMG/M
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009616	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100	Environmental	Open in IMG/M
3300009635	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10	Environmental	Open in IMG/M
3300009643	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40	Environmental	Open in IMG/M
3300009644	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10	Environmental	Open in IMG/M
3300009683	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG	Environmental	Open in IMG/M
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental	Open in IMG/M
3300009759	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10	Environmental	Open in IMG/M
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300014164	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG	Environmental	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014490	Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG	Environmental	Open in IMG/M
3300014491	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014654	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG	Environmental	Open in IMG/M
3300017940	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018008	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300019786	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300023056	Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2	Environmental	Open in IMG/M
3300023101	Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14	Environmental	Open in IMG/M
3300027545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)	Environmental	Open in IMG/M
3300027562	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)	Environmental	Open in IMG/M
3300027609	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027662	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)	Environmental	Open in IMG/M
3300027674	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028795	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1	Environmental	Open in IMG/M
3300029915	III_Bog_E1 coassembly	Environmental	Open in IMG/M
3300029954	I_Bog_N3 coassembly	Environmental	Open in IMG/M
3300029981	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2	Environmental	Open in IMG/M
3300030707	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)	Environmental	Open in IMG/M
3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Host-Associated	Open in IMG/M
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated	Open in IMG/M
3300031524	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097888

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FD2_08013810	2189573001	Grass Soil	PAVTVLFARLVLKEHFSRWKFVGLLAALAAVPLISAG
JGI12703J13194_1041661	3300001100	Forest Soil	PAITVLLARIFLHEHFSRTRTLGMVAALAAVPMIAG*
JGI12269J14319_100684841	3300001356	Peatlands Soil	PAVTVLLARIFLHEHFSRSRTIGMVAALAAVPMIAG*
Ga0070739_103436221	3300005532	Surface Soil	PALTVVLARIFLREHFTRWKTAGIIAALIAVPMIAAG*
Ga0068857_1000079901	3300005577	Corn Rhizosphere	VVTVLLARILLREHFTRWKLVGMITALIAVPMIAG*
Ga0070761_109708431	3300005591	Soil	VTVLMARLVLKEHFSRWKFIGLLAALAAVPMIASG*
Ga0070762_102665593	3300005602	Soil	LYPAMTVLLARLILKEHFSRWKLVGLLAALAAVPMIAAG*
Ga0070763_101563033	3300005610	Soil	TVLLARLFLKEHLTRWRFVGLLAALAAVPMIAGQ*
Ga0070763_101721721	3300005610	Soil	AITVLLARIFLHEHFSRARTIGMVAALAAVPMIAG*
Ga0068852_1023905932	3300005616	Corn Rhizosphere	ITVLMARIFLHEHFTRWKAVGILAALVAIPMIAKP*
Ga0066903_1012999773	3300005764	Tropical Forest Soil	YPAVTVLLARLILKEHFTRWRLVGLLAALAAVPMIAAG*
Ga0074479_109318344	3300005829	Sediment (Intertidal)	YPAVTVLLARFFLREHFTGWKIVGMLAALAAVPLIAAR*
Ga0066790_103080973	3300005995	Soil	LYPAVTVLLARLFLQEHFSRWKFIGLLAALAAVPMIAAG*
Ga0066790_104940302	3300005995	Soil	TVLLARIFMREHFTRWKLAGIAAALAAVPLIAAG*
Ga0075028_1008621522	3300006050	Watersheds	TVLLARLVLKERFSCWKFVGLLAALAAVPLIAAG*
Ga0075029_1012597952	3300006052	Watersheds	TVLLARLVLKEHFSRWKFIGLLAALAAVPMIAAG*
Ga0070716_1010772881	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	AITVLLARFFLHEHFSRSKTVGMLAALAAVPLVAG*
Ga0070765_1021133401	3300006176	Soil	PAVTVVLARIFLHEHFSRARTIGMVAALAAVPMIAG*
Ga0099792_106944431	3300009143	Vadose Zone Soil	AVTVLLARLFLHEHFTRWRFVGLLAALAAVPMIASP*
Ga0116111_11733312	3300009616	Peatland	PAVTVLLARIFLREHFSRARTIGMIAALVAVPMIAG*
Ga0116117_12116542	3300009635	Peatland	YPAVTVLLARFILKEHFTRWKALGMVAALLAVPMIAWR*
Ga0116110_10619993	3300009643	Peatland	PAITVLLARVFLHEHFSRARTIGMVAALAAVPMIAG*
Ga0116121_11286391	3300009644	Peatland	PAVTVLLARIILHEHFSRARTIGMVAALVAVPMIAG*
Ga0116224_104757962	3300009683	Peatlands Soil	AVTVLLARLILREHFTRWKALGMVGALLAVPMIAWR*
Ga0116216_107820752	3300009698	Peatlands Soil	VTVLLARLFLKEHFTRWRFIGLLAALAAVPMIAAG*
Ga0116101_10364281	3300009759	Peatland	PAITVLLACIFLKEHFTRWKFVGLLAALAAVPMIAAQ*
Ga0116134_10383443	3300009764	Peatland	AITVLLARVFLHEHFSRARTIGMVAALAAVPMIAG*
Ga0126373_102493923	3300010048	Tropical Forest Soil	ITVLLARLILKEQFTAWKVVGVLAALAAVPMIAAS*
Ga0134063_105911952	3300010335	Grasslands Soil	AITVLLARFVLHEHLSRWKLVGMVAALAAVALIAV*
Ga0134071_107202852	3300010336	Grasslands Soil	TILLARAILKEKFTPWKTAGMAAALAAVPMIARG*
Ga0074046_100477795	3300010339	Bog Forest Soil	YPAVTVLLARLVLKEHFSRWRLVGLLAALAAVPLIAAG*
Ga0074046_104351121	3300010339	Bog Forest Soil	YPTVTVLLARIFLHEHFSRARTFGMVAALVAVPMIAG*
Ga0074045_110533531	3300010341	Bog Forest Soil	VTVLLSRIFLREHFSRARTIGMIAALVAVPMIAG*
Ga0074044_103752792	3300010343	Bog Forest Soil	SLYPAVTVVLARIFLHEHFSRTRTIGMVAALVAVPMIAG*
Ga0074044_108986012	3300010343	Bog Forest Soil	VTVLLARLILHEHFTRWRAAGILAALVAVPLIAMQ*
Ga0126376_100267195	3300010359	Tropical Forest Soil	LYPAVTVMLARIFLHEHFSRWRLVGMIAALVAVPMIAG*
Ga0126378_131831332	3300010361	Tropical Forest Soil	LSSLYPTVTVLLARIVLKEHFTPWKFAGLLAALASVPMIAAG*
Ga0126381_1015327302	3300010376	Tropical Forest Soil	YPAVTVLLARIVLREHFSRWKLVGLLAALASVPLIAGG*
Ga0137393_100035841	3300011271	Vadose Zone Soil	PAVTVLLARLFLHEHFTRWRFVGLLAALAAVPMIASP*
Ga0137399_115114901	3300012203	Vadose Zone Soil	LYPAVTVLLARAFLKEHFTRWRLVGLLAALAAVPMIASG*
Ga0137381_101878451	3300012207	Vadose Zone Soil	SSLYPAITVLLARFFLHEHFSRSKTVGMLAALAAVPLVAG*
Ga0137377_106819242	3300012211	Vadose Zone Soil	SLYPVITILLAGMILKERFTPWKIAGMAAALAAVPMIARG*
Ga0137387_108814461	3300012349	Vadose Zone Soil	ITVLLARFVLHEHLSRWKLVGMVAALAAVALIAV*
Ga0137386_105692132	3300012351	Vadose Zone Soil	VTVVLARIFLHEHFSHARTIGMVAALAAVPMIAG*
Ga0137358_108774172	3300012582	Vadose Zone Soil	YPAITVLLARIFLHEHFSRSKTVGMLAALAAVPLVAG*
Ga0181532_102518921	3300014164	Bog	VTVVLARIFLHEHFSRARTLGMLAALAAVPMIAG*
Ga0182018_107517382	3300014489	Palsa	VTVLLARLFLQEHFTRWRFVGLLAALAAVPMIAAQ*
Ga0182010_100136871	3300014490	Fen	VTVVLARIFLHEHFSRARTLGMVAALIAVPMIAG*
Ga0182014_104880142	3300014491	Bog	SLYPAVTVLLARIFLHEHFSRARTIGMVAALAAVPMIAV*
Ga0182024_114843511	3300014501	Permafrost	SLYPTVTVLLARIFLHEHFSRARTIGMFAALAAVPMIAG*
Ga0181525_105427841	3300014654	Bog	LYPAVTVLLARIVLKEHFTRWRFVGLLAALAAVPMIAAH*
Ga0187853_102225431	3300017940	Peatland	PAVTVLLARVFLKEHFTRWRFVGLLAALAAVPMIAAQ
Ga0187817_108492001	3300017955	Freshwater Sediment	VTVLLARLVLKEHFSRWKFVGLLAALAAVPLIAAG
Ga0187781_110954431	3300017972	Tropical Peatland	TTVLLARLILKEHFSRWKLVGLLAALAAVPLIAAG
Ga0187782_101607072	3300017975	Tropical Peatland	PAVTVVLARVILHEHFTRWRAAGILAALAAVPMIAA
Ga0187888_12519512	3300018008	Peatland	PAVTVLLARLLLKEHFTRWRFVGLLAALAAVPMIAAG
Ga0187810_104065482	3300018012	Freshwater Sediment	YPAITVLLARLFLKEHFSRWKLIGLLAALAAVPLISAG
Ga0187857_100244871	3300018026	Peatland	SLYPAVTVLLARLLLKEHFTRWRFVGLLAALAAVPMIAAG
Ga0187863_100264581	3300018034	Peatland	LYPAVTVVLARIFLHEHFSRARTIGMVAALVAVPMIAG
Ga0187772_100557615	3300018085	Tropical Peatland	VTVLLARLVLKEHFSRWRFVGLLAALAAVPLIAAG
Ga0187769_101684513	3300018086	Tropical Peatland	SLYPAVTVLLARLVLKEHFSRWKFVGLLAALAAVPLIAAG
Ga0187770_100148358	3300018090	Tropical Peatland	PAVTVVLARLILHEHFTRWKAVGMFAALLAVPMIAGQ
Ga0187770_107387381	3300018090	Tropical Peatland	LYPAVTVLLARVFLHEHFSRGRTLGMLAALLAVPMIAG
Ga0182025_10607441	3300019786	Permafrost	YPAVTVLLARIFLQEHFTRWRFVGLLAALVAVPMIAAG
Ga0210403_105368192	3300020580	Soil	PAVTVLLAHFFLKEHFTRWKTAGILAALLAVPMIAMQ
Ga0210406_101917963	3300021168	Soil	PAVTVILARIVLKEHFSRWKVIGLLAALAAVPMIAAG
Ga0210385_106039751	3300021402	Soil	LYPAVTVLLARLFLKEHFSRWKLVGLLTALAAVPLIAAG
Ga0210409_109280182	3300021559	Soil	PVITVLLARVVLHERFTRWKMVGIFAALLAVPLIAM
Ga0233357_10592811	3300023056	Soil	AVTVLLARVFLKEHFTRWRFVGLLAALAAVPMIAAG
Ga0224557_11339431	3300023101	Soil	YPAITVLLARIFLHEHFSRARTLGMLAALAAVPMIAG
Ga0209008_10021611	3300027545	Forest Soil	PAVTVILARLILKEHFSRWRFIGLLAALAAVPMIAAG
Ga0209735_10034024	3300027562	Forest Soil	AVTVVLARIFLHEHFSRARTIGMVAALAAVPMIAG
Ga0209221_10401901	3300027609	Forest Soil	SLYPAVTVLLARVFLKEHFTRWRLIGLLAALTAVPMIAAG
Ga0208565_10383113	3300027662	Peatlands Soil	LYPAVTVVLARVFLHEHFSRARTIGMVAALVAVPMIAG
Ga0209118_10804091	3300027674	Forest Soil	LYPAVTVLLARLVLKEHFSRWKFIGLLAALAAVPMIAAG
Ga0209275_106735251	3300027884	Soil	YPAVTVLLARLFLQEHFSRWKFIGLLAALAAVPMIAAG
Ga0209006_109745372	3300027908	Forest Soil	AVTVLLARVFLKEQFTRWRFVGLLAALAAVPMIAGG
Ga0209698_102260643	3300027911	Watersheds	AITVLLARIVLKEHFSRWKFVGLLAALAAVPLIAAG
Ga0209069_109484931	3300027915	Watersheds	PAITVILARVFLREHFTRWKLVGMAAALAAVPLIATR
Ga0209168_100938735	3300027986	Surface Soil	LYPAMTVLLARLVLKEHFSRWKFVGLLAALAAVPLISAG
Ga0302227_103800562	3300028795	Palsa	SLYPVVTVLLARLFLHEHFSRGRTIGMVAALAAVPMIAG
Ga0311358_102086561	3300029915	Bog	AVTVLLARLFLKEHFTRWRFVGLLAALAAVPMIAAG
Ga0311331_106996931	3300029954	Bog	PAVTVILARIFLHEHFSRTRTIGMVAALAAVPMIAG
Ga0302293_101034752	3300029981	Fen	SLYPAVTVVLARIFLHEHFSRGRTIGMLAALAAVPMIAG
Ga0310038_104994762	3300030707	Peatlands Soil	PAVTVLLARLILKEHFSRWKFVGLLAALAAVPLIAAG
Ga0265325_101651392	3300031241	Rhizosphere	PAVTVLLARLVLKEHFSRWKFVGLLAALAAVPLLAAG
Ga0265331_103926221	3300031250	Rhizosphere	LYPAVTVVLARIFLREHFSRARTIGMLAALAAVPMIAG
Ga0302320_121325642	3300031524	Bog	AITVLLARMFLHEHFSRWKVVGMAAALLAVPLIAVSSH
Ga0307476_111849202	3300031715	Hardwood Forest Soil	LYPAVTVLLARIVLKEHFTRWRFVGLLAALAAVPMIAAQ
Ga0310813_112958521	3300031716	Soil	PAITVLIARIFLHEHFTRWKAVGILATLVAIPMIARS
Ga0307474_115184861	3300031718	Hardwood Forest Soil	SLYPAVTVLLARFFLDEHFSRWKFVGLLAALLAVPMIAW
Ga0307475_105929272	3300031754	Hardwood Forest Soil	VTVLLARIILKEHLTRWRFVGLIAALAAVPMIASQ
Ga0307475_111903881	3300031754	Hardwood Forest Soil	ITVLLARILLKEHFTRWKAVGVLAALAAVPMIAAG
Ga0307478_105263051	3300031823	Hardwood Forest Soil	VTVLLARLILEEHFTRWKALGMVAALLAVPMIAWR
Ga0318551_101719323	3300031896	Soil	SLYPAVTVLMARLVLKEHLNRIQAVGIGATLAAIPLIVA
Ga0306921_100401581	3300031912	Soil	LYPAVTVLLARLILDEHFTRRKALGMLAALLAVPMIAKG
Ga0306921_105428251	3300031912	Soil	PAVTVLLARVILKEQFSHWKVVGLLAALAAVPLIAAG
Ga0318533_113501562	3300032059	Soil	VTVLLARVILDEHFTRRKALGMLAALLAVPMIAKG
Ga0311301_102221215	3300032160	Peatlands Soil	YPAVTVLLARLFLREHFTRWRFVGLLAALAAVPMIAAQ
Ga0307471_1018692032	3300032180	Hardwood Forest Soil	YPAITVLLARFFLHEHFSRSKTVGMLAALAAVPLVAG
Ga0335080_106679421	3300032828	Soil	YPAVTVLLARVFLKEHFSRWRFIGLLAALASVPLIAAG
Ga0335077_104355051	3300033158	Soil	YPAVTVLLARLVLREHFTRWKAIGIFAAMLAVPLIAGQ
Ga0335077_112056131	3300033158	Soil	AVTVLLARLILKEHFSRWKFVGLLAALAAVPLISAG
Ga0310810_100066381	3300033412	Soil	LYPAITVLLARIFLHEKFTRWKTVGMLAALAAVPMIARA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign