Basic Information | |
---|---|
Family ID | F097891 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | AFAPPFNVHGTAHLSPSQPLGFTAAFPKREIQLGARFSF |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.94 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 88.46 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.731 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.346 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.654 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.692 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 15.38 |
PF00326 | Peptidase_S9 | 7.69 |
PF13847 | Methyltransf_31 | 6.73 |
PF12867 | DinB_2 | 3.85 |
PF00501 | AMP-binding | 2.88 |
PF13561 | adh_short_C2 | 1.92 |
PF00107 | ADH_zinc_N | 1.92 |
PF13181 | TPR_8 | 1.92 |
PF07519 | Tannase | 1.92 |
PF09957 | VapB_antitoxin | 0.96 |
PF02737 | 3HCDH_N | 0.96 |
PF01575 | MaoC_dehydratas | 0.96 |
PF02771 | Acyl-CoA_dh_N | 0.96 |
PF01494 | FAD_binding_3 | 0.96 |
PF05199 | GMC_oxred_C | 0.96 |
PF03446 | NAD_binding_2 | 0.96 |
PF13414 | TPR_11 | 0.96 |
PF02776 | TPP_enzyme_N | 0.96 |
PF09723 | Zn-ribbon_8 | 0.96 |
PF13424 | TPR_12 | 0.96 |
PF00069 | Pkinase | 0.96 |
PF08386 | Abhydrolase_4 | 0.96 |
PF12697 | Abhydrolase_6 | 0.96 |
PF02353 | CMAS | 0.96 |
PF13538 | UvrD_C_2 | 0.96 |
PF04185 | Phosphoesterase | 0.96 |
PF00924 | MS_channel | 0.96 |
PF00561 | Abhydrolase_1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.85 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.92 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.96 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.96 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.96 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.96 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.96 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.96 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.96 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.96 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.73 % |
Unclassified | root | N/A | 18.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119832016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300005181|Ga0066678_10820764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300005186|Ga0066676_10915832 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005440|Ga0070705_100801824 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005531|Ga0070738_10231687 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300005540|Ga0066697_10419513 | Not Available | 775 | Open in IMG/M |
3300005547|Ga0070693_101339635 | Not Available | 554 | Open in IMG/M |
3300005554|Ga0066661_10246221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1106 | Open in IMG/M |
3300005554|Ga0066661_10335789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300005568|Ga0066703_10436049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300005591|Ga0070761_10013761 | All Organisms → cellular organisms → Bacteria | 4525 | Open in IMG/M |
3300005602|Ga0070762_10833944 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005764|Ga0066903_101736694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300005764|Ga0066903_107658499 | Not Available | 556 | Open in IMG/M |
3300005921|Ga0070766_10551120 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300006028|Ga0070717_11838555 | Not Available | 547 | Open in IMG/M |
3300006173|Ga0070716_101008908 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300006176|Ga0070765_100679213 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300006797|Ga0066659_10654418 | Not Available | 856 | Open in IMG/M |
3300006800|Ga0066660_10269051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1343 | Open in IMG/M |
3300006800|Ga0066660_10319310 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300007076|Ga0075435_100062753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 3016 | Open in IMG/M |
3300009038|Ga0099829_11382698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300009088|Ga0099830_11368679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300009088|Ga0099830_11813758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009137|Ga0066709_103428483 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300009792|Ga0126374_11677925 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010048|Ga0126373_11357443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
3300010048|Ga0126373_11762463 | Not Available | 683 | Open in IMG/M |
3300010326|Ga0134065_10015977 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300010361|Ga0126378_12364134 | Not Available | 607 | Open in IMG/M |
3300010366|Ga0126379_10020245 | All Organisms → cellular organisms → Bacteria | 4968 | Open in IMG/M |
3300010376|Ga0126381_102284253 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300010376|Ga0126381_103172123 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300010379|Ga0136449_100909914 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300010398|Ga0126383_13255557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300011270|Ga0137391_10064834 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
3300011271|Ga0137393_11258108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300011436|Ga0137458_1045315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → unclassified Caldilineae → Caldilineae bacterium | 1168 | Open in IMG/M |
3300012096|Ga0137389_11209477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300012180|Ga0153974_1171913 | Not Available | 516 | Open in IMG/M |
3300012201|Ga0137365_10412223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
3300012203|Ga0137399_11316635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300012211|Ga0137377_11350754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300012361|Ga0137360_10084818 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300012929|Ga0137404_11323524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300012930|Ga0137407_10205100 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300012930|Ga0137407_11373108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300012931|Ga0153915_12440146 | Not Available | 612 | Open in IMG/M |
3300012948|Ga0126375_11139241 | Not Available | 645 | Open in IMG/M |
3300013307|Ga0157372_10582775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
3300014501|Ga0182024_12144112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300015264|Ga0137403_11033219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300016270|Ga0182036_10904951 | Not Available | 723 | Open in IMG/M |
3300016371|Ga0182034_11313960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300016387|Ga0182040_11983454 | Not Available | 500 | Open in IMG/M |
3300017974|Ga0187777_10375061 | Not Available | 981 | Open in IMG/M |
3300017975|Ga0187782_10880671 | Not Available | 694 | Open in IMG/M |
3300017995|Ga0187816_10539408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300018468|Ga0066662_11909016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300019888|Ga0193751_1058051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1632 | Open in IMG/M |
3300020581|Ga0210399_11405683 | Not Available | 545 | Open in IMG/M |
3300020583|Ga0210401_10603828 | Not Available | 959 | Open in IMG/M |
3300021168|Ga0210406_10025836 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
3300021168|Ga0210406_10429363 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300021171|Ga0210405_10891801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 676 | Open in IMG/M |
3300021401|Ga0210393_10022200 | All Organisms → cellular organisms → Bacteria | 4938 | Open in IMG/M |
3300021405|Ga0210387_10243344 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300021432|Ga0210384_10206025 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300021432|Ga0210384_10282629 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300021560|Ga0126371_13682517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300024178|Ga0247694_1013590 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300024295|Ga0224556_1098559 | Not Available | 716 | Open in IMG/M |
3300025915|Ga0207693_10295210 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300026313|Ga0209761_1230207 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300026467|Ga0257154_1055246 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300026552|Ga0209577_10443641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
3300026921|Ga0207860_1035732 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300027090|Ga0208604_1003936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
3300027684|Ga0209626_1023215 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300027729|Ga0209248_10076440 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300027846|Ga0209180_10575332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300027853|Ga0209274_10013730 | All Organisms → cellular organisms → Bacteria | 3639 | Open in IMG/M |
3300027882|Ga0209590_10368147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300027889|Ga0209380_10454227 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300027910|Ga0209583_10758300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300028536|Ga0137415_10248428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
3300030007|Ga0311338_10430278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
3300030503|Ga0311370_11534501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300031028|Ga0302180_10028861 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
3300031446|Ga0170820_10527878 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300031718|Ga0307474_10457372 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300031720|Ga0307469_12019291 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031747|Ga0318502_10093005 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300031754|Ga0307475_10218385 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300031820|Ga0307473_10404836 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300031945|Ga0310913_11141672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300032180|Ga0307471_102075797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300032205|Ga0307472_100134533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1775 | Open in IMG/M |
3300032261|Ga0306920_102032850 | Not Available | 804 | Open in IMG/M |
3300032261|Ga0306920_102547938 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032261|Ga0306920_103776617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300033513|Ga0316628_100237562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2221 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1198320162 | 3300002568 | Soil | VNNIVGASFAPPFSVHGTAINSPSQPLGFTAAFPKREIQVGIRFDF* |
Ga0066678_108207641 | 3300005181 | Soil | IVGAAFAPSFNVHGTASLSPSQPLGFTAALPKREVQLGIRFDF* |
Ga0066676_109158321 | 3300005186 | Soil | NNIVGAAFAPPFNVHGTANLSPSQPLGFTAALPKREVQLGIRFDF* |
Ga0070705_1008018242 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGPPFDLHGNSALSPSQPLGFTSAFPKRQMQLGVRLNF* |
Ga0070738_102316873 | 3300005531 | Surface Soil | FNVQGSALLSPSQPLSFTSDFPKREIQLGVRLSF* |
Ga0066697_104195131 | 3300005540 | Soil | VLAPPFDLSGSSASSPSKPLGFTSAFLKREIQLGLRLTF* |
Ga0070693_1013396351 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IANRTNYSTVNNVVGAAFVPPFNVRGSAALSPSQGLGYTGALPKREIQLGVRIDF* |
Ga0066661_102462211 | 3300005554 | Soil | AFAPPFDVHGTASLSPSQPLGFTAALPKREIQLGVRFDF* |
Ga0066661_103357891 | 3300005554 | Soil | RVNNIVGATLAPPFNVHGTSSLPPSQPLGFTAALPEREVQLGIRFDF* |
Ga0066703_104360491 | 3300005568 | Soil | LAGAAFAPPFNVRGTSTVSPSQPLGFTAAFPKREVQLGIRFEF* |
Ga0070761_100137611 | 3300005591 | Soil | FNVHGSAALSPSQPLGFTSDFPKREIQLGLRVTF* |
Ga0070762_108339441 | 3300005602 | Soil | FAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGLRFTF* |
Ga0066903_1017366943 | 3300005764 | Tropical Forest Soil | ATFGPPFHAHGTTDLSPSQPLGFTAALAKREIQLGVRFDF* |
Ga0066903_1076584992 | 3300005764 | Tropical Forest Soil | FGLPFNPHGTARLSPSQPLGFTAAFPKREIQLGVRLSF* |
Ga0070766_105511202 | 3300005921 | Soil | PGFTTFDVHGSKALSPSTPLGFTSALPKREIQLGVRMNF* |
Ga0070717_118385551 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PFHLSASSALSPSQPLAYTAALPRREIQLGVHLNF* |
Ga0070716_1010089081 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SVNNIVGAAFAPPFNVHGTAALSPSQALGFTAALPKREVQFGIRFDF* |
Ga0070712_1014027101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GPKVIGSTFNVHGTNTVSPSTPLGFTSAFPMRQLQLGIRIGF* |
Ga0070765_1006792132 | 3300006176 | Soil | TGNTSFDVHGSAALSPSQPLGFTSAFPKREIQLGLRITF* |
Ga0066659_106544181 | 3300006797 | Soil | LAPGFATFNVHGSRFLSPSQPLGFTSAFPKREIQLGLRLTF* |
Ga0066660_102690511 | 3300006800 | Soil | NNIVGATLAPPFNVHGTSSLSPSQPLGFTAALPKREVQLGVRFDF* |
Ga0066660_103193103 | 3300006800 | Soil | VNNIVGSAFAPPFSIHGTASLSPSQPLGFTAALPKREVQLGVRFDF* |
Ga0075435_1000627531 | 3300007076 | Populus Rhizosphere | SSVNNLVGAAFAPPFNVRGTSVVSPSQPLGFTAALAKREVQLGIRFEF* |
Ga0099829_113826981 | 3300009038 | Vadose Zone Soil | AAFAPPFSIHGTASLSPSQPLGFTAAFPKREVQVGIRFDF* |
Ga0099830_113686791 | 3300009088 | Vadose Zone Soil | SNRTNYASVNNIVGASFAPPFNVHGTAAVSPSQPRGFTAAFPKREIQLGVRFDF* |
Ga0099830_118137581 | 3300009088 | Vadose Zone Soil | APPFSVHGTTTISPSQPLGFTAAFPKREIQVGIHFDF* |
Ga0066709_1034284831 | 3300009137 | Grasslands Soil | NIVGAAFAPPFNVHGTANLSPSQPLGFTAALPKREVQLGIRFDF* |
Ga0126374_116779251 | 3300009792 | Tropical Forest Soil | TPFNVHGTANLYPNQPLAFTSALPKREIQLGARFEF* |
Ga0126373_113574433 | 3300010048 | Tropical Forest Soil | GAAFAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGARLTF* |
Ga0126373_117624631 | 3300010048 | Tropical Forest Soil | IVGAAFAPPFNVHGTANLGPSQALGFTAAFPNREIQLGVRFTF* |
Ga0134065_100159774 | 3300010326 | Grasslands Soil | VNNIVGAAFAPPFNANGTAGLSPSQPLGFTAALPKREIQLGLRFDF* |
Ga0126378_123641342 | 3300010361 | Tropical Forest Soil | GLIPSPFNLSGTSAGPSQPQGFTSALAKREVQLGVRVSF* |
Ga0126379_100202455 | 3300010366 | Tropical Forest Soil | GNPTANVHGSATIAPNQPLGFTSAFPMRQIQLGARVVF* |
Ga0126381_1022842533 | 3300010376 | Tropical Forest Soil | APPFNVHGTANVGPSQPLGFTAAFPNREIQLGARLTF* |
Ga0126381_1031721231 | 3300010376 | Tropical Forest Soil | AAPFNVHGTANVGPSQPLGFTAAFPNREIQLGVRLTF* |
Ga0136449_1009099141 | 3300010379 | Peatlands Soil | TFNVHGSSALSPSQPLGFTSAFPKREIQLGVRLTF* |
Ga0126383_132555572 | 3300010398 | Tropical Forest Soil | FKVHGSSALSPSQPLGFTSAFPKRQIQLGLRLTF* |
Ga0137391_100648346 | 3300011270 | Vadose Zone Soil | YASVNNIVGASFAPPFNVHGTAAVSPSQPRGFTAAFPKREIQLGVRFDF* |
Ga0137393_112581081 | 3300011271 | Vadose Zone Soil | IVGAAFAPPFSIHGTASLSPSQPLGFTAAFPKREVQVGIRFDF* |
Ga0137458_10453152 | 3300011436 | Soil | PFDLRGTSARSPSQPLGFTSAFPKRQFQFGVRLGF* |
Ga0137389_112094772 | 3300012096 | Vadose Zone Soil | GGAGATTFNVSGTSALSPSQPLGFTSAFPKREIQLGVRFDF* |
Ga0153974_11719132 | 3300012180 | Attine Ant Fungus Gardens | GPNFAPPFSVSGTNAVGPTSPLGFDAASAKRELQLGLRLAF* |
Ga0137365_104122233 | 3300012201 | Vadose Zone Soil | GAAFAPSFSVHGTAGLSPSQPLGFTAALPKREIQLGLRFDF* |
Ga0137399_113166352 | 3300012203 | Vadose Zone Soil | VNNIVGAAFVPPFSVHGTAINSPSQPLGFTAAFPKREIQVGIHFDF* |
Ga0137377_113507541 | 3300012211 | Vadose Zone Soil | GATTFNVSGTSALLPSQPLGFTSAFPKREIQLGVRVSF* |
Ga0137360_100848183 | 3300012361 | Vadose Zone Soil | VLAPPFDLSGSSASSPSKPLGFTSAFPKREIQLGLRLTF* |
Ga0137404_113235242 | 3300012929 | Vadose Zone Soil | PPFNANGTAGLSPSQPLGFTAALPKREIQLGLRFDF* |
Ga0137407_102051002 | 3300012930 | Vadose Zone Soil | GVIAPPFRLSGTEAASPSQPLGFTSTFAKREIQLGVRFNF* |
Ga0137407_113731081 | 3300012930 | Vadose Zone Soil | VNNIVGAAFAPPFNVRGTANLSPSQPLGFTAALPKREVQLGIRFDF* |
Ga0153915_124401462 | 3300012931 | Freshwater Wetlands | GSGHLTANVQGTNLVSPSQPLGFTSAYPMRQIQLGARLTF* |
Ga0126375_111392411 | 3300012948 | Tropical Forest Soil | FNVHGSAALSPSQPLGFTSAFPKREIQLALRVTF* |
Ga0157372_105827751 | 3300013307 | Corn Rhizosphere | TVNNIVGAAFAPPFAVRGTSAVSPSQPLGYTAALPKRELQLGVRFEF* |
Ga0182024_121441121 | 3300014501 | Permafrost | NIVGPAFAPPFNVHGTAALSPSQPLGFTADFPKREIQLGVRFNF* |
Ga0137403_110332191 | 3300015264 | Vadose Zone Soil | FAPPFNAHGTAGLSPSQPLGFTAALPKREIQLGLRFDF* |
Ga0182036_109049512 | 3300016270 | Soil | AAFAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGVRFTF |
Ga0182034_113139601 | 3300016371 | Soil | GAAFGPPFSVHGTANLGPSQPFGFTAAFPNREIQLGVRFTF |
Ga0182040_119834541 | 3300016387 | Soil | APPFNVHGTANVGPSQPLGFTAAFPNREIQLGARLTF |
Ga0187777_103750611 | 3300017974 | Tropical Peatland | IVGAAFAPPFNVHGTANLGPSQPLGFTAAFPNREIQLGVRLTF |
Ga0187782_108806712 | 3300017975 | Tropical Peatland | TTFAVHGSAALSPSTPLGFTSDFPKREIQLGVRLSF |
Ga0187816_105394081 | 3300017995 | Freshwater Sediment | TTFDVHGSAALSPSQPLGFTSAFPKREIQLGVRLMF |
Ga0066662_119090161 | 3300018468 | Grasslands Soil | GAAFAPPFNVHGTAMLSPSQPLGFTAALPKREIQLGIRFDF |
Ga0193751_10580514 | 3300019888 | Soil | APFAPPFSVHGTSINSPSQPLGFTAAFPKREIQVGIHFDF |
Ga0210399_114056832 | 3300020581 | Soil | VNNIVDAAFAPPFDVHGTASLSPSQPLGFTAAFPKREIQLGVRLSF |
Ga0210401_106038281 | 3300020583 | Soil | NIVGPAFAPPFHVHGTAALSPSQPLGFTADFPKREIQLGVQFYF |
Ga0210406_100258361 | 3300021168 | Soil | ANRTNYSSVNNIVGPDFAPPFNVHGTTALSPSQPRGFTADFPKREIQLGVQFNF |
Ga0210406_104293631 | 3300021168 | Soil | FSTFNVHGRADLSPSTPLGFTSDFPKRQIQLGARFSF |
Ga0210405_108918012 | 3300021171 | Soil | AFAPPFNVHGTAHLSPSQPLGFTAAFPKREIQLGARFSF |
Ga0210393_100222005 | 3300021401 | Soil | TTGNASFDVHGSAALSPSQPLGFTSAFPKRQIQLGLRFMF |
Ga0210387_102433442 | 3300021405 | Soil | QPGFTTFNVHGSADLSPSTPLGFTSAFPKRQIQLGARFTF |
Ga0210384_102060251 | 3300021432 | Soil | TPGFTTFDVHGSAALSPSQPLGFTSAFPKREIQLGLRFVF |
Ga0210384_102826291 | 3300021432 | Soil | FAPPFHVHGTAALSPSQPLGFTADFPKREIQLGVQFYF |
Ga0126371_136825172 | 3300021560 | Tropical Forest Soil | PPFNVHGTSLVSPSQALGFTAAFPKREIQLGARLSF |
Ga0247694_10135901 | 3300024178 | Soil | GATTFHVSGTSAVGPSQPLGFTSALPKREIQFGLRLSF |
Ga0224556_10985592 | 3300024295 | Soil | ADFAPPFDVRGTAALSPSQPLGFTAALPKRQVQLGARFNF |
Ga0207693_102952104 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PFNVHGTANLGPSQPLGFTAAFPNREIQLGVRFTF |
Ga0209761_12302072 | 3300026313 | Grasslands Soil | APPFDLSGSRASSPSKPLGFTSAFPKREIQLGLRLTF |
Ga0257154_10552461 | 3300026467 | Soil | TFNVHGSAALSPSTPLGFTSALPKREIQLGCRFNF |
Ga0209577_104436411 | 3300026552 | Soil | PFNVHGTSSLPPSQPLGFTAALPEREVQLGIRFDF |
Ga0207860_10357322 | 3300026921 | Tropical Forest Soil | NIVGAAFAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGVRLTF |
Ga0208604_10039363 | 3300027090 | Forest Soil | ADFAPPFNVHGTASLSPSQPLGFTAAFPNREIQLGVRLAF |
Ga0209626_10232151 | 3300027684 | Forest Soil | YSSVNNIVGPDFAPPFNVHGTAALSPSQPRGFTADFPKREIQLGVQFNF |
Ga0209248_100764402 | 3300027729 | Bog Forest Soil | TSFAVHGSSALSPSQPLGFTSAFPKREIQLGLRLTF |
Ga0209180_105753322 | 3300027846 | Vadose Zone Soil | NNIVGAAFAPPFSIHGTASLSPSQPLGFTAAFPKREVQVGIRFDF |
Ga0209274_100137304 | 3300027853 | Soil | NTTFNVHGSAALSPSQPLGFTSDFPKREIQLGLRVTF |
Ga0209590_103681471 | 3300027882 | Vadose Zone Soil | FNIANRTNYSAVNNVVGAAFAPRFNVRGTSALSPSQSLGYTAALPKREIQLGLRVDF |
Ga0209380_104542271 | 3300027889 | Soil | TPGFTTFNVHGSAALSPSTPLGFTSALPKREIQLGCRLNF |
Ga0209583_107583001 | 3300027910 | Watersheds | IVGAAFAPPFNVHGTASLSPSQPLGFTAAFPKREIQLGARFSF |
Ga0137415_102484282 | 3300028536 | Vadose Zone Soil | VNNIVGASFAPPFSVHGTAIKSPSQPLGFTAAFPKREIQVGIHFDF |
Ga0311338_104302782 | 3300030007 | Palsa | ATFAPSFNVHGTAALSPSQPLGFTAADAKREIQLGLRLAF |
Ga0311370_115345011 | 3300030503 | Palsa | NNIVGATFAPSFNVHGTPSLSPSQPLGFTAADSKREIQLGARLTF |
Ga0302180_100288613 | 3300031028 | Palsa | VGATFAPSFNVHGTASLSPSQPLGFTAADAKREIQLGLRLAF |
Ga0170820_105278782 | 3300031446 | Forest Soil | GFSTFNVHGRADLSPSTPLGFTSDFPKRQIQLGARFSF |
Ga0307474_104573722 | 3300031718 | Hardwood Forest Soil | PDFGPKFNVHGTASLSPSDPLGFTAAAPKREIQLGARFIF |
Ga0307469_120192911 | 3300031720 | Hardwood Forest Soil | AFGPQFNVHGTANLGPSQPLGFTAAFPNREIQLGVRFTF |
Ga0318502_100930051 | 3300031747 | Soil | AAFAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGARLTF |
Ga0307475_102183853 | 3300031754 | Hardwood Forest Soil | GNASFDVHGSAALSPSQPLGFTSAFPKRELQLGLRLTF |
Ga0307473_104048361 | 3300031820 | Hardwood Forest Soil | FGPQFNVHGTANLGPSQPLGFTAAFPNREIQLGVRFTF |
Ga0310913_111416722 | 3300031945 | Soil | NIVGAAFGPPFSVHGTANLGPSQPFGFTAAFPNREIQLGVRFTF |
Ga0307471_1020757972 | 3300032180 | Hardwood Forest Soil | APSFNVHGTASLSPSQPLGFTAAFPKREIQLGARFSF |
Ga0307472_1001345331 | 3300032205 | Hardwood Forest Soil | GGAGSTTFNVTGTSAIQPSLPLGFTSVFPKREIQLGLRLSF |
Ga0306920_1020328502 | 3300032261 | Soil | FSPNFTTFNVHGSKLLSPSQPLGFTSAFPKREIQLGLRLTF |
Ga0306920_1025479382 | 3300032261 | Soil | FAPPFNVHGTANVGPSQPLGFTAAFPNREIQLGARLTF |
Ga0306920_1037766172 | 3300032261 | Soil | PFSVHGTANLGPSQPFGFTAAFPNREIQLGVRFTF |
Ga0316628_1002375623 | 3300033513 | Soil | TTFHVSGTSAVGPSQPLGFTSALPKREIQFGLRLSF |
⦗Top⦘ |