NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097938

Metagenome Family F097938

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097938
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 41 residues
Representative Sequence MRFRAALVLGALLAVATSSTAFGQGFQGGLRGSIKDSGGV
Number of Associated Samples 87
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.12 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.269 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere
(8.654 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.808 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.65%    β-sheet: 0.00%    Coil/Unstructured: 57.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13442Cytochrome_CBB3 27.88
PF14559TPR_19 1.92
PF13620CarboxypepD_reg 0.96
PF00593TonB_dep_Rec 0.96
PF13378MR_MLE_C 0.96
PF00069Pkinase 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.27 %
UnclassifiedrootN/A6.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig43073All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
2170459007|GJ61VE201DVKK0All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300000956|JGI10216J12902_121363071All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300004157|Ga0062590_101833326All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300004643|Ga0062591_101071226All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300005174|Ga0066680_10272159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300005175|Ga0066673_10802471All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300005289|Ga0065704_10692603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300005332|Ga0066388_100776678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sandarakinorhabdus → unclassified Sandarakinorhabdus → Sandarakinorhabdus sp.1554Open in IMG/M
3300005332|Ga0066388_105458250All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300005356|Ga0070674_100399978All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300005444|Ga0070694_101174345All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300005444|Ga0070694_101466094All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300005457|Ga0070662_100847863All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300005457|Ga0070662_101410880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300005543|Ga0070672_101633334All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300005552|Ga0066701_10930809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005563|Ga0068855_100387488All Organisms → cellular organisms → Bacteria → Acidobacteria1534Open in IMG/M
3300005617|Ga0068859_100049352All Organisms → cellular organisms → Bacteria4227Open in IMG/M
3300005840|Ga0068870_10645062All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300005844|Ga0068862_100048140All Organisms → cellular organisms → Bacteria3639Open in IMG/M
3300005844|Ga0068862_100778985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium932Open in IMG/M
3300006173|Ga0070716_100178174All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300006178|Ga0075367_10398522All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300006791|Ga0066653_10634424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia545Open in IMG/M
3300006800|Ga0066660_10090771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2133Open in IMG/M
3300006854|Ga0075425_102438791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300006871|Ga0075434_100096570All Organisms → cellular organisms → Bacteria2960Open in IMG/M
3300006871|Ga0075434_101023167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300006904|Ga0075424_101097861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300006914|Ga0075436_101186870All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300009012|Ga0066710_101989137All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300009092|Ga0105250_10465054Not Available569Open in IMG/M
3300009094|Ga0111539_12765411Not Available568Open in IMG/M
3300009101|Ga0105247_10365143All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300009137|Ga0066709_101473893All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300009137|Ga0066709_103416445All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300009147|Ga0114129_10043018All Organisms → cellular organisms → Bacteria6357Open in IMG/M
3300009162|Ga0075423_10672312All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300009162|Ga0075423_11600348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300009176|Ga0105242_11309735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300009553|Ga0105249_10501266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1259Open in IMG/M
3300009553|Ga0105249_10630769All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300009553|Ga0105249_10896158All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300009792|Ga0126374_11208116All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300010304|Ga0134088_10070488All Organisms → cellular organisms → Bacteria → Acidobacteria1624Open in IMG/M
3300010323|Ga0134086_10393505All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300010358|Ga0126370_11468349All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300010362|Ga0126377_12852695Not Available557Open in IMG/M
3300010399|Ga0134127_13424232All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300010400|Ga0134122_12071503All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300010400|Ga0134122_12081556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300011269|Ga0137392_11219193All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300012189|Ga0137388_10903797All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300012206|Ga0137380_11360119All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300012209|Ga0137379_10804929All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300012212|Ga0150985_101703426All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300012212|Ga0150985_122294541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium931Open in IMG/M
3300012509|Ga0157334_1071590All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300012893|Ga0157284_10324758Not Available512Open in IMG/M
3300012911|Ga0157301_10272931All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300012925|Ga0137419_10611530All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300012927|Ga0137416_12059586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300012944|Ga0137410_11802025All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300013297|Ga0157378_10477363All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300014745|Ga0157377_11721990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300015371|Ga0132258_11877218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1509Open in IMG/M
3300016445|Ga0182038_11946952All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300018064|Ga0187773_10643668All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300018071|Ga0184618_10256783All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium740Open in IMG/M
3300021080|Ga0210382_10053260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1597Open in IMG/M
3300021080|Ga0210382_10206843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300025925|Ga0207650_11018192All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300025930|Ga0207701_11701504Not Available505Open in IMG/M
3300025949|Ga0207667_11423027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300025957|Ga0210089_1031871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300025960|Ga0207651_10433231All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300025961|Ga0207712_10024057All Organisms → cellular organisms → Bacteria → Acidobacteria4028Open in IMG/M
3300025961|Ga0207712_10453077All Organisms → cellular organisms → Bacteria → Acidobacteria1088Open in IMG/M
3300025961|Ga0207712_11341449All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025961|Ga0207712_11414789All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300025972|Ga0207668_11902062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300026035|Ga0207703_11762434All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300026067|Ga0207678_10864358All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300026095|Ga0207676_12436029Not Available520Open in IMG/M
3300026297|Ga0209237_1264541All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300028380|Ga0268265_10210862All Organisms → cellular organisms → Bacteria → Acidobacteria1692Open in IMG/M
3300028380|Ga0268265_11048284All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300028380|Ga0268265_12231746All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300028708|Ga0307295_10096953All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300028792|Ga0307504_10168067All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300029987|Ga0311334_11768421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300031057|Ga0170834_114128050All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300031231|Ga0170824_115869578All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300031562|Ga0310886_10054175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1830Open in IMG/M
3300031740|Ga0307468_100258672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300031858|Ga0310892_10480828All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300032126|Ga0307415_101873206All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300032180|Ga0307471_103532531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300032211|Ga0310896_10887574Not Available515Open in IMG/M
3300032770|Ga0335085_12179928All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300032782|Ga0335082_11377148All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300033433|Ga0326726_11144992All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300033807|Ga0314866_011223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1197Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere8.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0073.000033202166559005SimulatedMLGALLVVAAAGSAFGQGFQGGLRGSVKDAGGVIPALKSR
L02_031194602170459007Grass SoilMRFRAALLIGAFLAVVTSGTAFGQGFQGGLRGAVK
JGI10216J12902_12136307113300000956SoilMRIRAAFLLGAFLAAITSVTVHGQGFQGGLRGSIKDSGGVIPGIEV
Ga0062590_10183332613300004157SoilMRVRASLVFGALLVLVSPPLAAGQGFQGGLRGSLKDAGGVVPGV
Ga0062591_10107122613300004643SoilMRVRASLVFGALLVVLVSPPPAAGQGFQGGLRGSLKDAGGVV
Ga0066680_1027215913300005174SoilMRFPAALLLGAFFAVVASGTALGQGFQGGLRGAVKDAGGVIPGVEV
Ga0066673_1080247123300005175SoilMRTRAALLLAAFAVLSHAGAVFGQGFQGGLRGAVKDAGGVVPGVEVTLTN
Ga0065704_1069260313300005289Switchgrass RhizosphereMRIRVALMLGAFLAVITSASVFGQGFQGGLRGSVKDSGGVIPGVEVT
Ga0066388_10077667813300005332Tropical Forest SoilMKFRTALILGALLAVISPGFAIGQGFQGGLRGAIKDSGGVVPGVDVT
Ga0066388_10545825023300005332Tropical Forest SoilMRIRAALLLAAFLAVVTSGTAFGQGFQGGLRGSVKDAGGVVPGVE
Ga0070674_10039997823300005356Miscanthus RhizosphereMRVLASLVVGALLVLVTPHLAGGQGFQGGLRGALKDAGGVVPGVEVTLTN
Ga0070694_10117434523300005444Corn, Switchgrass And Miscanthus RhizosphereMRNRVALLLGAFLAVGISSAAFGQGFQGGVRGSVKDSGGVVPGVEVTLT
Ga0070694_10146609423300005444Corn, Switchgrass And Miscanthus RhizosphereMRFRAALILGALLALATTGTVFGQGFQGGIRGSIKDSGGVVP
Ga0070662_10084786313300005457Corn RhizosphereMRFRAALLFGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGV
Ga0070662_10141088023300005457Corn RhizosphereMRFRATLMGALLVVLTAGTVFGQGFQGGLRGSLKDAGGVVPG
Ga0070672_10163333423300005543Miscanthus RhizosphereMRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLKDAGG
Ga0066701_1093080923300005552SoilMRLRAALLLGALLTAFTAHAVYGQGFQGGLRGAVKDPG
Ga0068855_10038748823300005563Corn RhizosphereMRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIKD
Ga0068859_10004935213300005617Switchgrass RhizosphereMRFRAALLLGAFLAAVTSSTAFGQGFQGGLRGAIKDSGGVIPGVEVTLT
Ga0068870_1064506213300005840Miscanthus RhizosphereMRFRATLMLGALLVVAAASSVFGQGFQGGLRGSIKDAGGVIP
Ga0068862_10004814013300005844Switchgrass RhizosphereMKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSG
Ga0068862_10077898513300005844Switchgrass RhizosphereMRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLK
Ga0070716_10017817413300006173Corn, Switchgrass And Miscanthus RhizosphereMKIRAALALAFLLAVTHASGVFGQGFQGGLRGAVKDAGGVIP
Ga0075367_1039852213300006178Populus EndosphereMRFRATLMLGALLVVAAAGSVFGQGFQGGLRGSVKDSGG
Ga0066653_1063442413300006791SoilMRFRAALMFGALLAVLTTGTASGQGFQGGIRGSIKDSGG
Ga0066660_1009077133300006800SoilMRFRAALAFGAFIAAASATSVFGQGFQGGLRGAIKDPGGVLPGV
Ga0075425_10243879113300006854Populus RhizosphereMTIRLSAVVGALVVLLAASSAVGQGFYGGLRGSVKDSGGVIPGVEVT
Ga0075434_10009657033300006871Populus RhizosphereMRFRAALTVGALLAVIIPGLAFGQGFQGGLRGSIKDSG
Ga0075434_10102316723300006871Populus RhizosphereMRFRAALLLGAFLAVMTSSDAFGQGFQGGLRGSVKDSGG
Ga0075424_10109786123300006904Populus RhizosphereMKFRATLFVGALLAVISPGLAFGQGFQGGLRGSIKDSGGVVPGV
Ga0075436_10118687013300006914Populus RhizosphereMRIRASLILGAWVVVSVSASAFGQGFQGGLRGSIKDSGGVVPGVEVTL
Ga0066710_10198913733300009012Grasslands SoilMRFRAALMMGALLVVTTAGAVFGQGFQGGLRGSVKDSGGVIPGVEV
Ga0105250_1046505413300009092Switchgrass RhizosphereMRVRASLVFGALLVVLASSHLAAGQGFQGGLRGSLK
Ga0111539_1276541113300009094Populus RhizosphereMRLRAALLSAAFLAVVTTSTAFGQGFQGGLRGSIKDSGG
Ga0105247_1036514323300009101Switchgrass RhizosphereMSVRASLVFGAALVLASSLVAAGQGFQGGLRGSVKD
Ga0066709_10147389313300009137Grasslands SoilMMRTRAALLLAAFAVLSHAGAVFGQGFQGGLRGAVKDAGGVVPGVE
Ga0066709_10341644523300009137Grasslands SoilVVVTSSAAFGQGFQGGLRGSIKDSGGVIPGVEVTLTNE
Ga0114129_1004301843300009147Populus RhizosphereMRLRAALIGAFLTVAASGTLFGQGFQGGLRGSIKDAG
Ga0075423_1067231223300009162Populus RhizosphereMRFGASLMLGALLVVATANAGFGQGFQGGLRGSVKDAGG
Ga0075423_1160034813300009162Populus RhizosphereMLGAFLAVVTSGTVFGQGFQGGLRGAVKDSGGVIPGVE
Ga0105242_1130973523300009176Miscanthus RhizosphereMSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKDSGGVI
Ga0105249_1050126613300009553Switchgrass RhizosphereMRFRAALLLGAFLAVVTSGTASGQGFQGGLRGSVKDAGGVVPGVEVT
Ga0105249_1063076923300009553Switchgrass RhizosphereMKLRASLVVGALLVLVTSHRAAGQGFQGGLRGALKDAGGVVPGVEVTLT
Ga0105249_1089615813300009553Switchgrass RhizosphereMRLRAGLLPAAFLAVVTTSTAFGQGFQGGLRGSIKDSG
Ga0126374_1120811623300009792Tropical Forest SoilMTWLRAVLAGAVVTLATSGALFGQGFQGGIRGSVKDSGGVVP
Ga0134088_1007048833300010304Grasslands SoilMMGALLVVSTAGAVFGQGFQGGLRGSVKDSGGVIPGV
Ga0134086_1039350523300010323Grasslands SoilMRAALLLAALAVLTQAGTLFGQGFQGGLRGSIKDPGGVLPGVEVTLTN
Ga0126370_1146834913300010358Tropical Forest SoilMTWLRAVLAGAVVTLATSGALFGQGFQGGIRGSVKD
Ga0126377_1285269523300010362Tropical Forest SoilMRIRALFVGASLVVSVAVSAYGQGFQGGVRGSIKDSGGV
Ga0134127_1342423213300010399Terrestrial SoilMRFRAALIIGALLAVLSSGIAFGQGFQGGVRGSIKDSG
Ga0134122_1207150323300010400Terrestrial SoilMRVRASLVVGALLVLATPHLAAGQGFQGGLRGALKDAGGVVPGVEVTLL
Ga0134122_1208155613300010400Terrestrial SoilMRTRVALVLAVFLVGTASALFGQGFQGGLRGSIKDAVGVVPGVEV
Ga0137392_1121919313300011269Vadose Zone SoilMLGELLVVIAAGAVFGQGFKGGLRGSLKDSGGVVPG
Ga0137388_1090379713300012189Vadose Zone SoilMRFRAALVLGALLAMASSSTAFGQGFQGGLRGSIKDSGGVIPGVEVTL
Ga0137380_1136011923300012206Vadose Zone SoilMRFPAALLFGAFLAAVASGTALGQGFQGGLRGAVKDAGGVIPGVEV
Ga0137379_1080492913300012209Vadose Zone SoilMMRTRAALLLAVFAVLLQSSALFGQGFQGGLRGQIKDPGGVLPGAEVT
Ga0150985_10170342613300012212Avena Fatua RhizosphereMRFRAALVGALLVVVSSGLAFGQGFQGGLRGSVKDSGG
Ga0150985_12229454123300012212Avena Fatua RhizosphereMRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIK
Ga0157334_107159023300012509SoilMRFRAAFSLGAFLAVVTSSDALGQGFQGGLRGSLKDSGGVI
Ga0157284_1032475813300012893SoilMRIGASLVFGALLVVVVSPQPAAGQGFQGGLRGSLKDAG
Ga0157301_1027293113300012911SoilMRLRASLVVGAVLVLLTSHLAAGQGFQGGLRGSLKDTGGVVPGVE
Ga0137419_1061153013300012925Vadose Zone SoilMRAALVGAFLTVAASGTLFGQGFQGGLRGSIKDPG
Ga0137416_1205958613300012927Vadose Zone SoilMRAALLLGAILTLAVSGTLFAQGFQGGLRGSIKDAGGV
Ga0137410_1180202523300012944Vadose Zone SoilMRFRAALLLGAFVAALTSSTAFGQGFQGCLRGSIKDSG
Ga0157378_1047736333300013297Miscanthus RhizosphereVRFRATLIGALLVVLTAGTVFGQGFQGGLRGSLKDAGG
Ga0157377_1172199013300014745Miscanthus RhizosphereMRIRVALIGAFLAVVTSGTVFGQGFQGGLRGSVKDSGGVIP
Ga0132258_1187721813300015371Arabidopsis RhizosphereMRIRAALLIGALLAMISPGLVFGQGFQGGLRGAVKD
Ga0182038_1194695223300016445SoilMKVRAALIIGAFLAVLSPGGAFGQGFQGGLRGVIKDSGGVVPGVEVTL
Ga0187773_1064366813300018064Tropical PeatlandMRFRAALVLGALLAVATSSTAFGQGFQGGLRGSIKDSGGV
Ga0184618_1025678313300018071Groundwater SedimentMRVRASLVVGAVLVLATSHFAAGQGFQGGLRGSVKDSGG
Ga0210382_1005326023300021080Groundwater SedimentMRVRASLVVGAVLVLATSHLAAGQGFQGGLRGSLKDTGGVVPGVEV
Ga0210382_1020684323300021080Groundwater SedimentMRIRASLVVGAVLVLATSHFAAGQGFQGGLRGSVKDSG
Ga0207650_1101819223300025925Switchgrass RhizosphereMRLRASLVVGAVLVLLTSHLAAGQGFQGGLRGSLKDTGGV
Ga0207701_1170150423300025930Corn, Switchgrass And Miscanthus RhizosphereMRFRATLIFGALLVVATASSVFGQGFQGGLRGSIKDAGGV
Ga0207667_1142302723300025949Corn RhizosphereMRFRAALFLGALLLATHAGSVFGQGFQGGLRGSIKDAGGVIP
Ga0210089_103187123300025957Natural And Restored WetlandsMKFRSALILGALLAVISPGFAFGQGFQGGLRGSVK
Ga0207651_1043323133300025960Switchgrass RhizosphereMRFRAALLLGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGV
Ga0207712_1002405713300025961Switchgrass RhizosphereMRVRASLVFGALLVVLASPHLAAGQGFQGGLRGSLKDAGGVVPGVEVVLT
Ga0207712_1045307713300025961Switchgrass RhizosphereMKLRASLFVGALLVLVTSHLAAGQGFQGGLRGALKD
Ga0207712_1134144913300025961Switchgrass RhizosphereMKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGVVPGV
Ga0207712_1141478923300025961Switchgrass RhizosphereMRLRASLVVGAVLVLVTSHLAAGQGFQGGLRGSLKDTGGV
Ga0207668_1190206213300025972Switchgrass RhizosphereMRVRASLVFGALLVILASSHLAAGQGFQGGLRGSLKDAGGVVPGVEV
Ga0207703_1176243423300026035Switchgrass RhizosphereMSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKDSG
Ga0207678_1086435813300026067Corn RhizosphereMRFRATLILGALLVVAAAGSVFGQGFQGGLRGSVKD
Ga0207676_1243602923300026095Switchgrass RhizosphereMSVRASLVFGAALVLASSLVAAGQGFQGGLRGSIKD
Ga0209237_126454113300026297Grasslands SoilMRIRASLILGASLMVSITASVYGQGFQGGLRGSIKDSGG
Ga0268265_1021086233300028380Switchgrass RhizosphereMKFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGVVPG
Ga0268265_1104828413300028380Switchgrass RhizosphereMRFRAALIGALLVVVTAGSVFGQGFQGGIRGSLKDSGGV
Ga0268265_1223174623300028380Switchgrass RhizosphereMRFRATLIIGALLVVATAGSVFGQGFQGTLRGSIKDAGGVIPG
Ga0307295_1009695323300028708SoilMRVGATLVFGAVLVLALSPFAAGQGFQGGVRGSIKDSG
Ga0307504_1016806713300028792SoilMRFRAALVLGAVLLVVTSSAVFGQGFQGGLRGSIKDAGGVI
Ga0311334_1176842123300029987FenMKLRAALILGALLVLSTSNALFAQGFQGGLRGSVKDNGGVVPGVE
Ga0170834_11412805023300031057Forest SoilMRFRAALVVCALVSAATPNVVFGQGFQGGLRGAIKDAGGVVP
Ga0170824_11586957813300031231Forest SoilMRIRAALIIGALLVVTSSGVVFGQGFQGGLRGSIKDAGGV
Ga0310886_1005417513300031562SoilMKFRTALILGALLAVISPGFAFAQGFQGGLRGSIKDS
Ga0307468_10025867233300031740Hardwood Forest SoilMRFRAALIGALLVVVTAGHLFAQGFQGGIRGSLKDAGGVVPGVEVTLTN
Ga0310892_1048082823300031858SoilMRFRAALLLGAFLAVVTSSTAFGQGFQGGLRGAIKDSGGVIPGVE
Ga0307415_10187320623300032126RhizosphereMRFRGALIGALLVVATAGSVFGQGFQGGIRGSLKDAGGVVPGVEVT
Ga0307471_10353253123300032180Hardwood Forest SoilMRIRALVFGAVVVVSVAASVAGQGFQGGIRGSIKDSGGVVP
Ga0310896_1088757423300032211SoilMRIRVALMLGAFLATVTSVTVFGQGFQGGLRGSVK
Ga0335085_1217992823300032770SoilMRIRAALAGALLAVLAASPLFGQGFQGGLRGAMKDQ
Ga0335082_1137714823300032782SoilMRIRATLVGALLAVLAASPLFGQGFQGGLRGAVKDQGGVLPGVEVTL
Ga0326726_1114499223300033433Peat SoilMRFRAALVLGALLALASSSTAFGQGFQGGLRGSIKDSGGVIPGVEVTL
Ga0314866_011223_2_1303300033807PeatlandMRIRATLIGALLAVLAASPLFGQGFQGGLRGAFKDPGGVLPGV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.