NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098041

Metagenome Family F098041

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098041
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 131 residues
Representative Sequence MPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Number of Associated Samples 90
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 32.69 %
% of genes near scaffold ends (potentially truncated) 66.35 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (99.038 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(37.500 % of family members)
Environment Ontology (ENVO) Unclassified
(85.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.385 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.17%    β-sheet: 7.19%    Coil/Unstructured: 49.64%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF04404ERF 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10226336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes560Open in IMG/M
3300001589|JGI24005J15628_10068401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1295Open in IMG/M
3300006027|Ga0075462_10230904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes551Open in IMG/M
3300006027|Ga0075462_10262269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes510Open in IMG/M
3300006029|Ga0075466_1085888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes871Open in IMG/M
3300006029|Ga0075466_1149338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes602Open in IMG/M
3300006164|Ga0075441_10385296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes508Open in IMG/M
3300006737|Ga0098037_1219962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes616Open in IMG/M
3300006749|Ga0098042_1066557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes950Open in IMG/M
3300006752|Ga0098048_1204810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes582Open in IMG/M
3300006802|Ga0070749_10523842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes644Open in IMG/M
3300006810|Ga0070754_10388305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes612Open in IMG/M
3300006919|Ga0070746_10261528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes805Open in IMG/M
3300006919|Ga0070746_10542351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes505Open in IMG/M
3300006920|Ga0070748_1241393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes652Open in IMG/M
3300006920|Ga0070748_1287343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes586Open in IMG/M
3300006921|Ga0098060_1225568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes509Open in IMG/M
3300006924|Ga0098051_1177379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes560Open in IMG/M
3300006929|Ga0098036_1136915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes749Open in IMG/M
3300006990|Ga0098046_1094373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes666Open in IMG/M
3300007229|Ga0075468_10130692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes772Open in IMG/M
3300007229|Ga0075468_10184753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes615Open in IMG/M
3300007229|Ga0075468_10203082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes577Open in IMG/M
3300007276|Ga0070747_1098877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1077Open in IMG/M
3300007344|Ga0070745_1195440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes749Open in IMG/M
3300007555|Ga0102817_1091678All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes667Open in IMG/M
3300007640|Ga0070751_1196815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes785Open in IMG/M
3300008012|Ga0075480_10305795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes805Open in IMG/M
3300009001|Ga0102963_1039844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1953Open in IMG/M
3300009071|Ga0115566_10141598All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1508Open in IMG/M
3300009077|Ga0115552_1205276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes807Open in IMG/M
3300009193|Ga0115551_1109765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1288Open in IMG/M
3300009426|Ga0115547_1064108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1264Open in IMG/M
3300009435|Ga0115546_1302055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes546Open in IMG/M
3300009437|Ga0115556_1092285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1165Open in IMG/M
3300009447|Ga0115560_1227874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes718Open in IMG/M
3300009476|Ga0115555_1167695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes915Open in IMG/M
3300009481|Ga0114932_10058354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2458Open in IMG/M
3300009495|Ga0115571_1120162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1123Open in IMG/M
3300009497|Ga0115569_10136461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1191Open in IMG/M
3300009550|Ga0115013_10046084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales2388Open in IMG/M
3300009703|Ga0114933_10342201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes987Open in IMG/M
3300010148|Ga0098043_1195945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes560Open in IMG/M
3300010149|Ga0098049_1031629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1719Open in IMG/M
3300010316|Ga0136655_1037288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1556Open in IMG/M
3300010430|Ga0118733_102943904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes935Open in IMG/M
3300011013|Ga0114934_10432824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes584Open in IMG/M
3300017713|Ga0181391_1089360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes700Open in IMG/M
3300017737|Ga0187218_1070219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes856Open in IMG/M
3300017739|Ga0181433_1084098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes782Open in IMG/M
3300017744|Ga0181397_1079676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes875Open in IMG/M
3300017746|Ga0181389_1206185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes507Open in IMG/M
3300017748|Ga0181393_1115375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes684Open in IMG/M
3300017756|Ga0181382_1102557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes774Open in IMG/M
3300017762|Ga0181422_1013810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2684Open in IMG/M
3300017763|Ga0181410_1125637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes731Open in IMG/M
3300017769|Ga0187221_1149873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes691Open in IMG/M
3300017770|Ga0187217_1153061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes772Open in IMG/M
3300017773|Ga0181386_1145037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P727Open in IMG/M
3300017779|Ga0181395_1155553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes719Open in IMG/M
3300017782|Ga0181380_1112648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes939Open in IMG/M
3300017782|Ga0181380_1139276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes830Open in IMG/M
3300019751|Ga0194029_1038791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes768Open in IMG/M
3300020388|Ga0211678_10402461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes543Open in IMG/M
3300021957|Ga0222717_10492180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes662Open in IMG/M
3300021958|Ga0222718_10428886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes654Open in IMG/M
3300022065|Ga0212024_1036001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes850Open in IMG/M
3300022071|Ga0212028_1066466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes674Open in IMG/M
3300022072|Ga0196889_1097230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes538Open in IMG/M
3300022074|Ga0224906_1105717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes827Open in IMG/M
3300022164|Ga0212022_1072631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes528Open in IMG/M
3300022167|Ga0212020_1086102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes526Open in IMG/M
3300022187|Ga0196899_1153473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes638Open in IMG/M
3300024346|Ga0244775_11422396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes533Open in IMG/M
3300025071|Ga0207896_1035932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes834Open in IMG/M
3300025102|Ga0208666_1059030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1047Open in IMG/M
3300025132|Ga0209232_1002198All Organisms → Viruses9799Open in IMG/M
3300025138|Ga0209634_1076133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1558Open in IMG/M
3300025508|Ga0208148_1015163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P2275Open in IMG/M
3300025508|Ga0208148_1129074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes513Open in IMG/M
3300025543|Ga0208303_1017955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2051Open in IMG/M
3300025543|Ga0208303_1083947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes700Open in IMG/M
3300025652|Ga0208134_1062102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1140Open in IMG/M
3300025671|Ga0208898_1085966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes997Open in IMG/M
3300025694|Ga0209406_1238040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes525Open in IMG/M
3300025759|Ga0208899_1047785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1854Open in IMG/M
3300025759|Ga0208899_1177817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes698Open in IMG/M
3300025759|Ga0208899_1197308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes643Open in IMG/M
3300025769|Ga0208767_1105529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1117Open in IMG/M
3300025769|Ga0208767_1195037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes686Open in IMG/M
3300025769|Ga0208767_1231318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes594Open in IMG/M
3300025853|Ga0208645_1194624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes724Open in IMG/M
3300025853|Ga0208645_1279216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300025889|Ga0208644_1282188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes669Open in IMG/M
3300025890|Ga0209631_10280391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes816Open in IMG/M
3300025892|Ga0209630_10133739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1283Open in IMG/M
3300027859|Ga0209503_10596022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes551Open in IMG/M
3300028022|Ga0256382_1079747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P780Open in IMG/M
3300028600|Ga0265303_10492311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P985Open in IMG/M
3300029787|Ga0183757_1024048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1392Open in IMG/M
3300031774|Ga0315331_11139227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes523Open in IMG/M
3300032274|Ga0316203_1237872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300032277|Ga0316202_10397432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes644Open in IMG/M
3300034375|Ga0348336_187559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes567Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous37.50%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine10.58%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.88%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface2.88%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.92%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.96%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.96%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.96%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.96%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.96%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.96%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1022633613300000117MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTP
JGI24005J15628_1006840123300001589MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFKDKTDEEIKEYIQNQEQLATQSNGFRTKYYSRHYLRWRNTPYRSQRHLKDQLDVFLSVLRSKSKV*
Ga0075462_1023090423300006027AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPY
Ga0075462_1026226923300006027AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRW
Ga0075466_108588823300006029AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVF
Ga0075466_114933823300006029AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEEIKKYIQEQEQLASKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0075441_1038529623300006164MarineLAKIKIRCEAITRTSIKLNEPRRCKAKGYFVPTSKRMLCRFHGCSKTIDSKTRKYKGLYKNNNIPIQNKIKLLKNLVNFRNKTDEEIKQYIQDQEKLANKSNRYRTKFYTRHHLRWRNTSYRNQRHFKDQLDVFLQVLRS
Ga0098037_121996223300006737MarineMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRFRTKYYTRHYLRWRNTPYRSQR
Ga0098042_106655733300006749MarineLPKIKIRCEGISRKSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEYIQEQEQLASQSDRFRAKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0098048_120481023300006752MarineMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHL
Ga0070749_1052384223300006802AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSVLRSKSKV*
Ga0070754_1038830513300006810AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSK
Ga0070746_1026152823300006919AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLK
Ga0070746_1054235113300006919AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRW
Ga0070748_124139323300006920AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHL
Ga0070748_128734323300006920AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKLLKNLVNFKDKTDDEIKEYIQNQEQLASQSDRFRTKYYTRHYLRWR
Ga0098060_122556823300006921MarineMGKIKIQCEAIARHSGKRCRCKGYFTPTSRRMLCTYHKASKSWNHKTRKYMGLYRNNRIDIQAKINMLKNLKNFKNKTDDEIKRYIQDQEQLASKSNRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQ
Ga0098051_117737923300006924MarineCRAQGYYTSTTRRMLRSINRESQTKDTKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0098036_113691513300006929MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSV
Ga0098046_109437313300006990MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASKSNRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0075468_1013069213300007229AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSK
Ga0075468_1018475323300007229AqueousRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEEIKKYIQEQEQLASKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0075468_1020308213300007229AqueousLPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKLLKNLVNFKDKTDDEIKEYIQNQEQLASQSDRFRTKYYTRHYLRW
Ga0070747_109887723300007276AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLD
Ga0070745_119544013300007344AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRS
Ga0102817_109167813300007555EstuarineQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSNGYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0070751_119681523300007640AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQ
Ga0075480_1030579523300008012AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLK
Ga0102963_103984413300009001Pond WaterIPLPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115566_1014159823300009071Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSNRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115552_120527623300009077Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRFRTKYYTRHYLRWRNTPYRNQRHFKDQLDVFLSVLRSKSKV*
Ga0115551_110976523300009193Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115547_106410823300009426Pelagic MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115546_130205523300009435Pelagic MarineMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGYQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRFRTKYYTRHYLRWRNTPYRSQ
Ga0115556_109228543300009437Pelagic MarineLPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115560_122787423300009447Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115555_116769513300009476Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0114932_1005835473300009481Deep SubsurfaceMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKSENEIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0115571_112016223300009495Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTNEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRNQRHLKDQLDVFLSVLRSKSKV*
Ga0115569_1013646123300009497Pelagic MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSNRYRTKYYTRHYLRWRNTPYRNQRHFKDQLDVFLSVLRSKSKV*
Ga0115013_1004608473300009550MarineMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDFFLSVLRSKSKV*
Ga0114933_1034220113300009703Deep SubsurfaceMAKIKIRCEAIAKHSGKRCKCLGRFIPTSRRMLCPYHKGGKSWDNKTRKYKGLYKNNKVPIQNKIKLLKNLINFRNKSEDEIKKYIQDQEKLATQSNRYRTKYYSRHYLRWRNTSYRNQRHLKDQLDVFLQILGSKSKV*
Ga0098043_119594513300010148MarineMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEYIQEQEQLASQSDRFRAKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0098049_103162913300010149MarineMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSK
Ga0136655_103728863300010316Freshwater To Marine Saline GradientEEIQLPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV*
Ga0118733_10294390413300010430Marine SedimentMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSNRYRTKYYTRHYLRWRNTPYRNQRHFKDQLD
Ga0114934_1043282423300011013Deep SubsurfaceMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKSENEIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTSYRSQRHLKDQL
Ga0181391_108936023300017713SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKKYIQEQEQLAFKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKPKV
Ga0187218_107021923300017737SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKKYIQEQEQLAFKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQV
Ga0181433_108409823300017739SeawaterMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRS
Ga0181397_107967623300017744SeawaterMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0181389_120618513300017746SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDDQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQILGSKSKV
Ga0181393_111537523300017748SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRS
Ga0181382_110255713300017756SeawaterMPKIKIRCEGTSKQSGLRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSDRYRTKYYTR
Ga0181422_1013810103300017762SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEEIKKYIQEQEQLASKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0181410_112563713300017763SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYR
Ga0187221_114987323300017769SeawaterMPKIKIRCEGTSKQSGLRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0187217_115306123300017770SeawaterKVMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKKYIQEQEQLAFKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKPKV
Ga0181386_114503723300017773SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0181395_115555313300017779SeawaterMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0181380_111264823300017782SeawaterMPKIKIRCEGTSKQSGLRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0181380_113927613300017782SeawaterMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRNKSENEIKKYIQEQEQLASQSDRFRAKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSVLRSK
Ga0194029_103879113300019751FreshwaterSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0211678_1040246113300020388MarineRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0222717_1049218023300021957Estuarine WaterAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0222718_1042888623300021958Estuarine WaterMPKLKIRCEAISKQSGVRCRAKGYFTPTTRRMLCRFHRGCKSWDSKTRKYKGLYKNTNIDIQKKIIILRNLKNFKNKTDEEIRNYIQEQEKQSNSYRYRTKYYTRHYLRWRNTAYRNKRHLKDQLDDFLQILGSKSKV
Ga0212024_103600113300022065AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSVLRSKSKV
Ga0212028_106646623300022071AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKD
Ga0196889_109723013300022072AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0224906_110571723300022074SeawaterYQVIMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0212022_107263113300022164AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFKHKTDEEIKEYIQNQEQLATQSNRFRTKYFVRHYLRWRNTPYRSQRHLKDQLDLFLSVL
Ga0212020_108610213300022167AqueousMVKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSVLR
Ga0196899_115347313300022187AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQL
Ga0244775_1142239623300024346EstuarineIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0207896_103593223300025071MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFKDKTDEEIKEYIQNQEQLATQSNGFRTKYYSRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0208666_105903023300025102MarineMPKIKIRCEGISKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0209232_100219893300025132MarineMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFKHKTDEEIKEYIQNQEQLATQSNGFRTKYYLRSYLRWRNTPYRNQRHLKDQLDVFLQVLRSKSKV
Ga0209634_107613323300025138MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFKDKTDEEIKEYIQNQEQLATQSNGFRTKYYSRHYLRWRNTPYRSQRHLKDQLDVFLSVLRSKSKV
Ga0208148_101516353300025508AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVTIQNKIKRLKNLINFRDKTDEEIKKYIQEQEQLASKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0208148_112907413300025508AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQR
Ga0208303_101795513300025543AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0208303_108394713300025543AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRS
Ga0208134_106210213300025652AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0208898_108596613300025671AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYR
Ga0209406_123804013300025694Pelagic MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRNQRHFKD
Ga0208899_104778553300025759AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQ
Ga0208899_117781723300025759AqueousLPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVF
Ga0208899_119730823300025759AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQL
Ga0208767_110552923300025769AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSK
Ga0208767_119503723300025769AqueousLPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQL
Ga0208767_123131823300025769AqueousLPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIENQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSK
Ga0208645_119462423300025853AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLASQSNGFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0208645_127921623300025853AqueousMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLD
Ga0208644_128218823300025889AqueousMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFL
Ga0209631_1028039123300025890Pelagic MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEEIKEHIQNQEQLATQSNRYRTKYYTRHYLRWRN
Ga0209630_1013373913300025892Pelagic MarineMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIQNQEQLATQSNGYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0209503_1059602213300027859MarineMPKIKIRCEGISRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEQIKEHIQNQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDLFLSVLRSKSK
Ga0256382_107974723300028022SeawaterMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0265303_1049231123300028600SedimentMPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSNGYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0183757_102404823300029787MarineMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLINFRDKTDEQIKEHIENQEKLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0315331_1113922713300031774SeawaterEMPKIKIGCEGISKQSGKRCRAKGYFTPNSRRMLCRFHGGSKSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLINFRDKTDEEIKKYIQEQEQLASKSDRFRAKYFVRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0316203_123787213300032274Microbial MatMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRN
Ga0316202_1039743213300032277Microbial MatLPKIKIRCEGTSRQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVSIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLATQSDRYRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKSKV
Ga0348336_187559_1_4113300034375AqueousMPKIKIRCEGTSKQSGKRCRAKGYFTPTSRRMLCRFHGGSQSTDSKTRKYKGLYNNKNVPIQNKIKRLKNLVNFRDKTDEQIKEHIQNQEQLASQSDRFRTKYYTRHYLRWRNTPYRSQRHLKDQLDVFLQVLRSKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.