NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098319

Metagenome / Metatranscriptome Family F098319

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098319
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 102 residues
Representative Sequence MKVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEPLL
Number of Associated Samples 81
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.50 %
% of genes near scaffold ends (potentially truncated) 31.73 %
% of genes from short scaffolds (< 2000 bps) 79.81 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(20.192 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(37.500 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.31%    β-sheet: 21.54%    Coil/Unstructured: 66.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02580Tyr_Deacylase 12.50
PF00408PGM_PMM_IV 8.65
PF02880PGM_PMM_III 5.77
PF00072Response_reg 2.88
PF05359DUF748 1.92
PF00834Ribul_P_3_epim 1.92
PF13083KH_4 1.92
PF01434Peptidase_M41 0.96
PF11897DUF3417 0.96
PF13701DDE_Tnp_1_4 0.96
PF01435Peptidase_M48 0.96
PF07963N_methyl 0.96
PF01055Glyco_hydro_31 0.96
PF00482T2SSF 0.96
PF00005ABC_tran 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 14.42
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 14.42
COG1490D-aminoacyl-tRNA deacylaseTranslation, ribosomal structure and biogenesis [J] 12.50
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 1.92
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 1.92
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.96
COG1501Alpha-glucosidase/xylosidase, GH31 familyCarbohydrate transport and metabolism [G] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908038|B3_all_c_ConsensusfromContig111621All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1052Open in IMG/M
2140918008|ConsensusfromContig206354All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia790Open in IMG/M
2140918024|NODE_215611_length_806_cov_6.205956All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia856Open in IMG/M
3300001213|JGIcombinedJ13530_100063397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia515Open in IMG/M
3300001213|JGIcombinedJ13530_101235676All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia677Open in IMG/M
3300001213|JGIcombinedJ13530_102822887All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia547Open in IMG/M
3300001213|JGIcombinedJ13530_106059077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia568Open in IMG/M
3300001213|JGIcombinedJ13530_109557301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia801Open in IMG/M
3300006930|Ga0079303_10280985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia684Open in IMG/M
3300006949|Ga0075528_10216325All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia521Open in IMG/M
3300009091|Ga0102851_10774679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1023Open in IMG/M
3300009091|Ga0102851_11349471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia790Open in IMG/M
3300009167|Ga0113563_10369630All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300009175|Ga0073936_10143338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1817Open in IMG/M
3300009502|Ga0114951_10091829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1742Open in IMG/M
3300009502|Ga0114951_10233813All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium969Open in IMG/M
3300009548|Ga0116107_1090589All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia929Open in IMG/M
3300009618|Ga0116127_1035182All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1512Open in IMG/M
3300009621|Ga0116116_1064628All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium1062Open in IMG/M
3300009639|Ga0116122_1083882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1046Open in IMG/M
3300009640|Ga0116126_1032753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2168Open in IMG/M
3300010341|Ga0074045_10274840All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1109Open in IMG/M
3300010379|Ga0136449_103019220All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia656Open in IMG/M
3300014158|Ga0181521_10001274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula31479Open in IMG/M
3300014158|Ga0181521_10096801All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1823Open in IMG/M
3300014490|Ga0182010_10733982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia557Open in IMG/M
3300014491|Ga0182014_10018861All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5983Open in IMG/M
3300014496|Ga0182011_10210498All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1319Open in IMG/M
3300014498|Ga0182019_10126551All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1594Open in IMG/M
3300014498|Ga0182019_10532990All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia817Open in IMG/M
3300014502|Ga0182021_10138114All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2834Open in IMG/M
3300014502|Ga0182021_12655514All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia602Open in IMG/M
3300014839|Ga0182027_11386859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia696Open in IMG/M
3300016702|Ga0181511_1192118All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia771Open in IMG/M
3300016702|Ga0181511_1231391All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia783Open in IMG/M
3300016750|Ga0181505_10790569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia534Open in IMG/M
3300017929|Ga0187849_1093081All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1292Open in IMG/M
3300017931|Ga0187877_1003638All Organisms → cellular organisms → Bacteria12385Open in IMG/M
3300017941|Ga0187850_10249144All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia799Open in IMG/M
3300017941|Ga0187850_10437894All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia568Open in IMG/M
3300018005|Ga0187878_1133358All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia978Open in IMG/M
3300018012|Ga0187810_10214091All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia785Open in IMG/M
3300018014|Ga0187860_1001091All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula24690Open in IMG/M
3300018021|Ga0187882_1039522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2335Open in IMG/M
3300018021|Ga0187882_1309189All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia605Open in IMG/M
3300018023|Ga0187889_10187310All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia959Open in IMG/M
3300018024|Ga0187881_10047940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2094Open in IMG/M
3300018026|Ga0187857_10546829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia517Open in IMG/M
3300018030|Ga0187869_10398750All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia656Open in IMG/M
3300018033|Ga0187867_10670845All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia565Open in IMG/M
3300018035|Ga0187875_10257207All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia952Open in IMG/M
3300018038|Ga0187855_10173061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1281Open in IMG/M
3300018040|Ga0187862_10423709All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia813Open in IMG/M
3300018043|Ga0187887_10604837All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia647Open in IMG/M
3300018057|Ga0187858_10752791All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia579Open in IMG/M
3300018085|Ga0187772_10630441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia764Open in IMG/M
3300021070|Ga0194056_10035697All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1926Open in IMG/M
3300022555|Ga0212088_10235940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium1399Open in IMG/M
3300023090|Ga0224558_1043879All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1890Open in IMG/M
3300023091|Ga0224559_1014838All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3376Open in IMG/M
3300023101|Ga0224557_1077974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1415Open in IMG/M
3300025162|Ga0209083_1070839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1439Open in IMG/M
3300025496|Ga0208191_1039980All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1045Open in IMG/M
3300025576|Ga0208820_1028323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1727Open in IMG/M
3300025725|Ga0209638_1067812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1373Open in IMG/M
3300025836|Ga0209748_1127593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium946Open in IMG/M
3300025857|Ga0209014_10011854All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula4465Open in IMG/M
3300025865|Ga0209226_10039631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales2130Open in IMG/M
3300025888|Ga0209540_10043073All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2787Open in IMG/M
3300027887|Ga0208980_10725269All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia561Open in IMG/M
3300027896|Ga0209777_10054259All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3606Open in IMG/M
3300027896|Ga0209777_10181583All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1708Open in IMG/M
3300027902|Ga0209048_10197219All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1467Open in IMG/M
3300031834|Ga0315290_10507754All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1052Open in IMG/M
3300031997|Ga0315278_10936454All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia867Open in IMG/M
3300031997|Ga0315278_11470804All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia657Open in IMG/M
3300032164|Ga0315283_10421314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1452Open in IMG/M
3300032164|Ga0315283_11029322All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia870Open in IMG/M
3300032177|Ga0315276_10545075All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1247Open in IMG/M
3300032256|Ga0315271_10146674All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1846Open in IMG/M
3300032401|Ga0315275_10320964All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1734Open in IMG/M
3300032516|Ga0315273_10246252All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300032783|Ga0335079_10238477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2004Open in IMG/M
3300032805|Ga0335078_10015153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula11441Open in IMG/M
3300032829|Ga0335070_10774746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia893Open in IMG/M
3300032892|Ga0335081_10398852All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1771Open in IMG/M
3300032893|Ga0335069_11060851All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium896Open in IMG/M
3300032897|Ga0335071_11023742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia772Open in IMG/M
3300033402|Ga0326728_10001403All Organisms → cellular organisms → Bacteria85205Open in IMG/M
3300033402|Ga0326728_10080469All Organisms → cellular organisms → Bacteria4185Open in IMG/M
3300033402|Ga0326728_10155348Not Available2462Open in IMG/M
3300033482|Ga0316627_100212221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1504Open in IMG/M
3300033482|Ga0316627_100802408All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium890Open in IMG/M
3300033483|Ga0316629_10036783All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2309Open in IMG/M
3300033485|Ga0316626_11036122All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia729Open in IMG/M
3300033513|Ga0316628_100499163All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1570Open in IMG/M
3300033513|Ga0316628_100567499All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1475Open in IMG/M
3300033521|Ga0316616_100085007All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2706Open in IMG/M
3300033521|Ga0316616_100954285All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1064Open in IMG/M
3300033521|Ga0316616_101466932All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium883Open in IMG/M
3300033521|Ga0316616_101825246All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium800Open in IMG/M
3300033521|Ga0316616_104680340All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia515Open in IMG/M
3300033557|Ga0316617_100569617All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1045Open in IMG/M
3300033890|Ga0334810_086865All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia754Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland20.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil17.31%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.73%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.73%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland5.77%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil5.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.85%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.88%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.88%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.88%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion1.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.96%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021070Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025836Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_all_c_021720502124908038SoilMQSKSMKVFLRDTQTGWYYQEPSKWTPEQEAAQDLAQVARAVELIFEAHLDNVEILLCYDDPRYDLVLPVPPSPSRQDSTKGRSASRDGLQPDRGKSAAAGKKDSLM
Bog_all_C_019796002140918008SoilMKVFIRNTQTGWYYQEPSKWTPEPEAACNLGQVAKAVERIFEAHLENVEILLSYDEPRYDLILAVPPSPSRGDSLRRHSTSEESRHGEAGQPAVPRKKGSRL
B_all_v_004254702140918024SoilMQSKSMKVFLRDTQTGWFFQEPSKWTPEQEAAQDLAQVARAVELIFEAHLDNVEILLCYDDPRYDLVLPVPPSPSRQDSTKGRSASRDGLQPDRGKSAAAGKKDSLM
JGIcombinedJ13530_10006339713300001213WetlandMKVFLRDTQNGWYYQEPSKWTPQQEAALDVTQVARAVELIFEAHLENMEILLCYDDPRYDLVLPVPPSPSRHDPLGYRHPSRDVFQPDTGKSAIPRKKEPLM*
JGIcombinedJ13530_10123567623300001213WetlandMDYVCAIGRPQCRIGRERAGAGGQIESMKVFIRNTQTGWYFQEPSKWTPDQGAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLVLSVPPSPSQADPLRQRHARDNGRHGKDAHPEPPRKKSPPV*
JGIcombinedJ13530_10282288723300001213WetlandKVFIRNTQTGWFFQEPSKWSPDQGAACDLGQVARAVERIFEAHLENVEILLSYAEPRYDLILPVPPSPSRSDPLRQRHARENSQHGKDAPPPSPQKKEPPM*
JGIcombinedJ13530_10605907713300001213WetlandMKVFLRNTQTGWFYQGPSGWTPDQDVAQDLAQVARAVELIFAAHLENVEILLCYDDPRYDLILPVPPSPSRPDALRHRHSNRDGLDSHKERPHQPRKKDPLM*
JGIcombinedJ13530_10955730123300001213WetlandMKVYIRNTKTGWYFQEPSKWTQEQGSACDLEQVAKAVERIFADHLEDVEILLSYDEPRYDLVLPVPPSPSHSEAPPRAQPGEESHPREHGRASGPRKKGPLL*
Ga0079303_1028098523300006930Deep SubsurfaceMKVFIRKTKTGWYYQEPSKWTADQGAACDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLILPVPPSPSRRAPLRQGQPGEESRQGERDRPAIPRKKEPPL*
Ga0075528_1021632513300006949Arctic Peat SoilTQNGWYYQEPSKWTPKQEAALDVAQVARAVELIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRHDSARGHLTSRDGPKPEEGKSAIARKKDHLM*
Ga0102851_1077467923300009091Freshwater WetlandsMKVFIRRTKNGWYYQEPAKWTPDQKEAHDLKQVARAVEKIFQDRLEDVEILLSYDEPRYDLVLPVPTSPSRLAPPRPSKVSEQGLSGEDAPPAVQPKKAPSF*
Ga0102851_1134947123300009091Freshwater WetlandsSPAAAGMQSGPMKVFIRKTKTGWYYQEPSKWTADQGAACDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLVLPVPPSPSRRDPLRQRQPGEESRQRETGHPAIPRKKGPPL*
Ga0113563_1036963013300009167Freshwater WetlandsMKVFIRNTKSGWYYQAPSKWTPDQGAGLDLGQVARAVERIFEHHLENVEILLSYDEPRYDLVLPVPPPPARGEALKRQQSTEESRHGEDGRSINPRKKGPQ
Ga0073936_1014333833300009175Freshwater Lake HypolimnionMKVFLRNTQTGWFFQEPSQWTPDQGAACNLEQVARAVERIFEAHLENVEILLSYDEPRYDLVLAVPPSPSRADPLRPRHARENSHHGKDALPTTPRKKEPPM*
Ga0114951_1009182913300009502FreshwaterMKVFLRDTQNGWYYQAPSRWTPEQEAAHDLAQVARAVELIFEAHLDNVEILLCYDDPRYDLVLPVPPSPSRHDPLRDRPSSRDSHQADQANSASPRKKDPLM*
Ga0114951_1023381323300009502FreshwaterMNVFIRHTKTGWYYQEPSQWTPDPGKGCDLGQVAKAVERIFELHLENVEILLSYDEPRYDLILPVPPSPSRTDPRKQRQPDTEEHPRETVQPATQAKKAPHL*
Ga0116107_109058913300009548PeatlandMQRESMKVFIRNTQTGWYYQEPSKWTPEQEAACDLGQVARAVERIFEAHLDNVEILLSYDEPRYDLILPVPPSPSRGDSLRRHQISEETHHREADQPMLPRKKRPLM*
Ga0116127_103518243300009618PeatlandMKVFLRNTQTGWYYQEPSKWAPAQEAAQNLAQVARAVELIFAAHLENVEILLCYDDPRYDLVLPVPPSPSQHDPLRHRHSSRDGLEPDKGKSAIPRKKDSLM*
Ga0116116_106462833300009621PeatlandMQRESMKVFIRNTQTGWYYQEPSKWTPELEDACDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSSRRRQSSEESRHGEAGQPTLTRKKEPPQ*
Ga0116122_108388213300009639PeatlandEQSEFMKVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEPLL*
Ga0116126_103275353300009640PeatlandMKVFLRNTQTGWYYQGPSKWTLEQDAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRQGEKGKSASPGKKEPLL*
Ga0074045_1027484023300010341Bog Forest SoilMKVFIRNTQTGWYYQAPSAWTPEQAGACDLRQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSWGDSLSRRQASEASGPGEEGRPTISRKKRPLL*
Ga0136449_10301922023300010379Peatlands SoilMKVFLRSTQTGWYYEGPSTWTPQQVAAQDLAQTARAVELIFEAHLENVEILLSYDNPRYDLVLTVPPSPFREDPLRRRQTAGDSLLGENGKSAIPGKKQPPL*
Ga0181521_10001274123300014158BogMKVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEPLL*
Ga0181521_1009680133300014158BogMKVFLRNTQSGWFYKEPSGWTPEQDAAQNLLQVARAVELIFAAHLENVEILLSYDDPRYDLVLPVPPSPFQHDPQRHRHASRDTVEQDEGKSATPRKKDSLM*
Ga0182010_1073398213300014490FenTGWYYQEPSKWTADQGAACDLAQVARAVERIFEAHLENVEIFLSYDEPRYDLVLPVPPSPSRVDPLRQPRASESGSHGKEAHPASPRKKEHPL*
Ga0182014_1001886133300014491BogMQSKSMKVFLRNTQTGWFYQEPSRWTPAQEEALDLAQVARAVERIFETHLENVEILLCYDDPRYDLILPVPPTPSWDESSGRRQPSGETLSGEKGQSAAPGSKGRLL*
Ga0182011_1021049833300014496FenMKVYIRNAQTGWYYQEPSKWTADQGAACDLAQVARAVERIFEAHLENVEIFLSYDEPRYDLVLPVPPSPSRVDPRRQPRASESGSHGKEAHPASPRKKEHPL*
Ga0182019_1012655133300014498FenMKVFLRNTQTGWFYQEPSKWTPAQEEALDLAQVARAVERIFEAHLENVEILLCYDDPRYDLILPVPPSPSRDEALGQRQPNRDSLPGEKGKPSAPGSKGRQL*
Ga0182019_1053299023300014498FenMKVFIRNTQNGWYYQEPSRWTPELEDAWDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRRRQSSEESRHGEAGQPTLTR
Ga0182021_1013811433300014502FenMKVFIRNAQTGWYYQEPSKWTADQGAACDLAQVARAVERIFEAHLENVEIFLSYDEPRYDLVLPVPPSPSRVDPLRQPRASESGSHGKEAHPASPRKKEHPL*
Ga0182021_1265551413300014502FenGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLSYDDPRYDLVLPVPPSPSRRDPFGQRQPRGESRHGEKGKLASPGKKEPLL*
Ga0182027_1138685913300014839FenGWTPEQDAAQNLAQVARAVELIFAAHLENVEILLCYDDPRYDLVLPVPPSPFQHDSLRHRHASRDTVEQDEGKSATQRKKDSLM*
Ga0181511_119211813300016702PeatlandRSESALVAGKQCKAMKVFLRNTQSGWFYKEPSGWTPEQDAAQNLLQVARAVELIFAAHLENVEILLSYDDPRYDLVLPVPPSPFQHDPQRHRHASRDTVEQDEGKSATPRKKDSLM
Ga0181511_123139123300016702PeatlandAQSSRTAEIKEELAGAEESTKSMKVFLRNTQTGWYYQGPSKWTSQQEEAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSDESRPGEKGKTASPGKKEPLL
Ga0181505_1079056913300016750PeatlandSEPAGAGTKIESMKVFIRNTQTGWFFQEPSKWTPDQGAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLVLPVPPSPSQADPLRQQRAPENGRHGKDARPEPPRKKWPPV
Ga0187849_109308123300017929PeatlandMKVFLRNTQTGWYYQEPSKWAPAQEAAQNLAQVARAVELIFAAHLENVEILLCYDDPRYDLVLPVPPSPSQHDPLRHRHSSRDGLEPDKGKSAIPRKEDTLM
Ga0187877_100363863300017931PeatlandMKVFIRNTQTGWYYQEPSKWTPEQEAACDLGQVARAVERIFEAHLDNVEILLSYDEPRYDLILPVPPSPSRGDSLRRHQISEETHHREADQPMLPRKKRPLM
Ga0187850_1024914423300017941PeatlandMQRESVKVFIRNTQTGWYYQEPSKWTPELEDACDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRRRQSSEESRHGEAGQPTLTRKKEPPQ
Ga0187850_1043789413300017941PeatlandKEPSGWTPEQDAAQNLLQVARAVELIFAAHLENVEILLSYDDPRYDLVLPVPPSPFQHDPQRHRHASRDTVEQDEGKSATPRKKDSLM
Ga0187878_113335833300018005PeatlandMQRESVKVFIRNTQTGWYYQEPSKWTPELEDACDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRRRQSSEESRHGEA
Ga0187810_1021409113300018012Freshwater SedimentPAGAGKRSEPMKVFLRNTETGWFYQEPSKWTPEQDVAQDLGQVTRAVELIFSAHLENVEILLSYDDPRYDLVLPVPPSPSRHDPLRQRRSSRDDLEQEKGKSALPSKKDHLM
Ga0187860_1001091173300018014PeatlandMKVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEPLL
Ga0187882_103952233300018021PeatlandMKVFIRNTQSGCYYQEPSKWTPEQKSASDLGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRHRQTSEESRPEEEGRPTIARKKRPLL
Ga0187882_130918913300018021PeatlandMQRESMKVFIRNTQTGWYYQEPSKWTPELEDACDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSSRRRQSSEESRHGEADQPTLTRKKEPPQ
Ga0187889_1018731013300018023PeatlandTGWYYQEPSKWAPAQEAAQNLAQVARAVELIFAAHLENVEILLCYDDPRYDLVLPVPPSPSQHDPLRHRHSSRDGLEPDKGKSAIPRKKDSLM
Ga0187881_1004794033300018024PeatlandMQRESMKVFIRNTQTGWYYQEPSKWTPEQEAACDLGQVARAVERIFEAHLDNVEILLSYDEPRYDLILPVPPSPSRGDSLRRHQISEETHHREADQPMLPRKKRPLM
Ga0187857_1054682913300018026PeatlandMKVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEP
Ga0187869_1039875013300018030PeatlandMKVFLRNTQTGWFYQGPSKWTPEQEAAENLAQVARAVERIFEAHLENVEILLCYDDPRYDLILPVPPSPSRPDPLGRRQPSGESRPGEKGKSARSGKKEPLL
Ga0187867_1067084513300018033PeatlandIRDTQTGWYYQEPSKWTPDQGVACDLGQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGETRPGEKGKSASPGKKEPLL
Ga0187875_1025720733300018035PeatlandMKVFLRNTQSGWFYKEPSGWTPEQDAAQNLLQVARAVELIFAAHLENVEILLSYDDPRYDLVLPVPPSPFQHDPQRHRHASRDTVEQDEGKSATPRKKDSLM
Ga0187855_1017306123300018038PeatlandMKVFLRNTQTGWFYEGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLILPVPPSPSRPDPLGRRQPSGESRPGEKGKSARSGKKEPLL
Ga0187862_1042370913300018040PeatlandMKVFLRNTQTGWFYQGPSKWTPEQEAAENLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLDRRQASGEIRPREKGK
Ga0187887_1060483713300018043PeatlandMKVFLRNTQTGWFYEGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLDRRQASGEIRPREKGK
Ga0187858_1075279113300018057PeatlandNTQTGWFYEGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRQGEKGKSASPGKKEPLL
Ga0187772_1063044123300018085Tropical PeatlandMRVFIRNTQNGWYYQEPSGWVPEQSAACDLGQVAKAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRRPQNGEESRRAEAGR
Ga0194056_1003569733300021070Anoxic Zone FreshwaterMKVFLRNTQTGWFFQEPSQWTPDQGAACNLEQVARAVERIFEAHLENVEILLSYDEPRYDLVLAVPPSPSRADPLRPRHARENSHHGKDALPTTPRKKEPPM
Ga0212088_1023594023300022555Freshwater Lake HypolimnionMNVFIRHTKTGWYYQEPSQWTPDPGKGCDLGQVAKAVERIFELHLENVEILLSYDEPRYDLILPVPPSPSRTDPRKQRQPDTEEHPRETVQPATQAKKAPHL
Ga0224558_104387923300023090SoilMQSKSMKVFLRNTQTGWFYQEPSRWTPAQEEALDLAQVARAVERIFETHLENVEILLCYDDPRYDLILPVPPTPSWDESSGRRQPSGETLSGEKGQSAAPGSKGRLL
Ga0224559_101483823300023091SoilMRVFLRNTQSGWFYKEPSGWTPEQDAAQNLAQVARAVELIFAAHLENVEILLCYDDPRYDLVLPVPPSPFQHDSLRHRHASRDTVEQDEGKSATQRKKDSLM
Ga0224557_107797433300023101SoilMKVFLRNTQTGWFYQEPSRWTPAQEEALDLAQVARAVERIFETHLENVEILLCYDDPRYDLILPVPPTPSWDESSGRRQPSGETLSGEKGQSAAPGSKGRLL
Ga0209083_107083913300025162FreshwaterMKVFLRDTQNGWYYQAPSRWTPEQEAAHDLAQVARAVELIFEAHLDNVEILLCYDDPRYDLVLPVPPSPSRHDPLRDRPSSRDSHQADQANSASPRKKDPLM
Ga0208191_103998043300025496PeatlandVFLRDTQTGWYYQGPSKWTPEQEAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRPGEKGKSTSPGKKEPLL
Ga0208820_102832323300025576PeatlandMKVFLRNTQTGWYYQGPSKWTLEQDAAEDLAQVARAVERIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRPDPLGRRQPSGESRQGEKGKSASPGKKEPLL
Ga0209638_106781213300025725Arctic Peat SoilMKVFLRDTQNGWYYQEPSKWTPKQEAALDIAQVARAVELIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRHDPLEHRHPSRNSFQLDTGNLAISRKKEPLM
Ga0209748_112759313300025836Arctic Peat SoilEPSKWTPKQEAALDIAQVARAVELIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRHDPLEHRHPSRNSFQLDTGNLAISRKKEPLM
Ga0209014_1001185453300025857Arctic Peat SoilMKVFLRDTQNGWYYQEPSKWTPKQEAALDVAQVARAVELIFEAHLENVEILLCYDDPRYDLVLPVPPSPSRHDPLEHRHPSRNSFQLDTGNLAISRKKEPLM
Ga0209226_1003963113300025865Arctic Peat SoilMKVFLRDTQNGWYYQEPSKWTPKQEAALDVAQVARAVELIFEAHLENVEILLCYDEPRYDLVLPVPPSPSRHDPLEHRHPSRNSFQLDTGNLAISRKKEPLM
Ga0209540_1004307353300025888Arctic Peat SoilMKVFLRDTQNGWYYQEPSKWTPKQEAALDVAQVARAVELIFEAHLENVEILLCYDEPRYDLVLPVPPSPSRHDPLEHRHPSRNSFQLDAGNLAISRKKEPLM
Ga0208980_1072526913300027887WetlandMKVFIRNTQTGLYFQEPSKWTPDQKAACNLGQVARAVERIFESHLENVEILLSYDEPRYDLILPVPPSPSRRAPLRQGQPGEESRQGERDRPAIPRKKEPPL
Ga0209777_1005425943300027896Freshwater Lake SedimentMKVFIRNTQTGWYYQEPSKWTPDQGAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLVLPVPPSPSRVDPLRQRHASENGRNGKEARPAVPPKKGPTL
Ga0209777_1018158333300027896Freshwater Lake SedimentMKVFIRDARTGWYYQEPSKWTPDQGAACDLAQVARAVERIFEAHLENVEIFLSYDEPRYDLVLPVPPSPSQVDPLRQRRASENGSHGKEARAALPRKKEHPL
Ga0209048_1019721933300027902Freshwater Lake SedimentMKVFIRNTQTGWYYQEPSKWTPDQGAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLVLPVPPSPSRVDPLTQRHASENGRHGKGARPPSPRKKEPPM
Ga0315290_1050775423300031834SedimentMKVFLRNTQTGWYYQEPSKWTPAQEEALDLALVARAVERIFETHLENVEILLCYDDPRYDLILPVPPWPSLDSSGRRRPSGESLAGEKGKSADQENKGHRL
Ga0315278_1093645423300031997SedimentPQYRIGRECAGALIEIESMKVFIRNTQNGWYFKEPSEWTPDQGAACDLGQVARAVERIFEAHLENVEILLSYHEPRYDLVLQVPPSPSRPDPLRQRHASANSGPGKEARPALPRKKEPPL
Ga0315278_1147080413300031997SedimentMKVFIRNTQTGWYFKEPSEWTPDQGAACDLGQVARAVERIFEARLENVEILLSYHEPRYDLVLQVPPSPSRPDPLRQRHASEISGHGKEAQPALPRKKEPPM
Ga0315283_1042131433300032164SedimentMKRKPAGAGMQLESMKVFIRNTQNGWYYQEPSKWTPELEDACDVGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRRRQSREESRHGEASQPTLPRKKGSPL
Ga0315283_1102932213300032164SedimentKSMKVFLRNTQTGWYYQEPSKWTPAQEEALDLALVARAVERIFETHLENVEILLCYDDPRYDLILPVPPWPSLDSSGRRRPSGESLAGEKGKSADQENKGHRL
Ga0315276_1054507523300032177SedimentMKVFLRNTQTGWYYQEPSKWTPAQEEALDLALVARAVERIFETHLENVEILLCYDDPRYDLILPVPPWPSLDSSGRRRPSRESLAGEKGKSADQENKGHRL
Ga0315271_1014667433300032256SedimentMKVFLRNTQTGWYYQEPSKWTPAQEEALDLAQVARAVERIFEAHLENMEILLSYDDPRYDLILAVPPSPSRDGSSGRHQPRSESLPEEKG
Ga0315275_1032096423300032401SedimentMQIESMKVFIRSTKNGWYYQEPSDWTPDQGAACDLRQVARAVEKIFHARLEDVEILLSYDEPRYDLVLPVPPSPSRSAPPRQRQASEESRLGEDAPPGIQPKKGPPL
Ga0315273_1024625253300032516SedimentLRNTQTGWYYQEPSKWTPAQEEALDLAQVARAVERIFEAHLQDVEILLCYDDPRYDLILPVPPVPSRYDSPGRRQPSGESLPGEKGKSATPGNKGHLM
Ga0335079_1023847723300032783SoilMKVFIRNTQTGWYFKEPSTWTPDHDEACDIGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRSESSKRRHSSEESRQASHPTLPRKKEPSL
Ga0335078_1001515353300032805SoilMKVFLRNTQTGWFYQDPSKWTPEQEAAQDLGQVTRAVELIFSAHLENIEILLCYDDPRYDLVLPVPPSPSRHESLRQHQSSRDDVEPEPGKSTIPRKKDHLM
Ga0335070_1077474623300032829SoilVKVFIRNTQTGWYYQEPSKWTPHQAAACDLGQVARAVEQIFEAHLENVEILLSYDEPRYDLVLPVPPSPSRLDPLKQRHLSESGRTGKEARSAGPRKKGPLL
Ga0335081_1039885233300032892SoilMKVFLRNTQTGWFYQEPSKWTPEQEAAQDLGQVTRAVELIFSAHLENIEILLCYDDPRYDLVLPVPPSPSRHESLRQRQSSRDDVEPEPGKSTIPRKKDHLM
Ga0335069_1106085133300032893SoilKVYIRNTKSGWYYREPSNRTPDQAAAYDLGQVAKAVERIFEAHLEDVEILLSYDDPRYDLILPVPASPSRGTSASRRQTSEPSLPSDEQRPALSNKKRSRL
Ga0335071_1102374213300032897SoilMKVFLRNTQTGWFYKEPPGWTPEQEAALDLAQVARAVELIFSAHLENVEILLCYDDPRYDLVLPVPASPSRQDALRPRRSNPDSFEHHKDKSSIP
Ga0326728_10001403483300033402Peat SoilMKVFIRNTQTGWYYQAPSAWTPEQAGACDLRQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSQGDSLRYRQTTEEDRSGEAVRPTLPRKKGPLL
Ga0326728_1008046923300033402Peat SoilMKVFIRNTQTGWYYQEPSRWIPDQAAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLVLPVPPSPSRPDPLKQRHATETGRHGKEARPSAPRKKEPPL
Ga0326728_1015534843300033402Peat SoilMKVFIRNTQTGWYYQAPSAWTAEQAAACDLGQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRGDSLRHRQTTEENRSGEAVWPTLPRKKGPLL
Ga0316627_10021222113300033482SoilMQSGPMKVFIRKTKTGWYYQEPSKWTPDQGAAYDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLVLPVPPSPSRRDPLRQRPPSEESRQGERDHPAIPRKKGPLL
Ga0316627_10080240813300033482SoilMKVFIRRTKNGWYYQEPAKWTPDQKEAHDLKQVARAVERIFQDRLEDVEILLSYDEPRYDLVLPVPTSPSRLAPPRPTKVSEQGLSGEDAPPAVQPKKAPSF
Ga0316629_1003678333300033483SoilMKVFIRRTKNGWYYQEPAKWTPDQKEAHDLKQVARAVEKIFQDRLEDVEILLSYDEPRYDLVLPVPTSPSRLAPPRPTKVSEQGLSGEDAPPAVQPKKAPSF
Ga0316626_1103612213300033485SoilMKVFIRNTKSGWYYQAPSKWTPDQGAGLDLGQVARAVERIFEHHLENVEILLSYDEPRYDLVLPVPPPPARGEALKRQQSTEESRHGEDGRSINPRKKGPQL
Ga0316628_10049916313300033513SoilMKVFIRKTKTGWYYQEPSKWTPDQGAACDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLVLPVPPSPSRRDSLRRRQPSEESRQGERDRPAIPRKKEPPL
Ga0316628_10056749913300033513SoilMQYESMRVFIRNTQTGWYYQEPSQWTPDQETACDLRQVARAVERIFEAHLENVEILLSYDEPRYDLILPVPPSPSRAEGLRRRQTGDEARPGETSQPPAVRKKGPPL
Ga0316616_10008500723300033521SoilMKVFIRRTKNGWYYQEPAKWTPDQKEAHDLKQVARAVEKIFQDRLEDVEILLSYDEPRYDLVLPVPTSPSRLAPPRPSKVSEQGLSGEDAPPAVQPKKAPSF
Ga0316616_10095428513300033521SoilMKVFIRKTKTGWYYQEPSEWTPDQGAAYDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLVLPVPPSPSRRDPPRQRHHSEEGRQGKTGHPAIAPKKEPPL
Ga0316616_10146693213300033521SoilGLRIKSMKVFIRNTKSGRFYQEQSKWTSDQGGACDLGQVAKAVERIFSEHLENVEILLSYDEPRYDLVLPVPPSPSRGDPLKRRHSSEEGRQGENNRHGMARKKGHPL
Ga0316616_10182524613300033521SoilMCLQEGSHNAEWKQWPAVAGVQIESMKVFIRSTKNGWYYQEPSTWTPDQGAASDLEQVARAVERIFQQRLEEVEILLSYDEPRYDLVLPVPPSPSRPEPAGQRKAKEQSRPREDIPPATHPKKRHPL
Ga0316616_10468034013300033521SoilMKVFIRKTKTGWYYQEPSKWTADQGAACDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLILPVPPSPSRRAPLRQGQPGEESRQGERDRPAIPRKKEPPL
Ga0316617_10056961713300033557SoilMKVFIRKTKTGWYYQEPSEWTPDQGAAYDLGQVARAVERIFEAQLEDVEILLSYDEPRYDLVLPVPPSPSRRDPPRQSHHSEEGRQGKTGHPAIAPKKEPPL
Ga0334810_086865_2_3673300033890SoilSRTANTEEDPAEAGKQSKFMKVFLRNTQTGWYYQEPSKWTADQGAACDLAQVARAVERIFEAHLENVEIFLSYDEPRYDLVLPVPPSPSRVDPLRQPRASESGSHGKEAHPASPRKKEHP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.