Metagenome / Metatranscriptome Family F098412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F098412
Family Type	Metagenome / Metatranscriptome
Number of Sequences	103
Average Sequence Length	49 residues
Representative Sequence	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS
Number of Associated Samples	68
Number of Associated Scaffolds	103

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	6.80 %
% of genes near scaffold ends (potentially truncated)	64.08 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (89.320 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (69.903 % of family members)
Environment Ontology (ENVO)	Unclassified (88.350 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (82.524 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 37.18% β-sheet: 0.00% Coil/Unstructured: 62.82%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 103 Family Scaffolds
PF02992	Transposase_21	1.94
PF07727	RVT_2	0.97

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
All Organisms	root	All Organisms	10.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
cellular organisms	root	All Organisms → cellular organisms	10.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	10.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	10.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	8.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	5.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.85 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	3.88 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3.88 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.88 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.88 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.88 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	89.32 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.88 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005330\|Ga0070690_101565772	Not Available	534	Open in IMG/M
3300005347\|Ga0070668_101607376	Not Available	596	Open in IMG/M
3300005617\|Ga0068859_101706467	Not Available	696	Open in IMG/M
3300009972\|Ga0105137_105587	Not Available	619	Open in IMG/M
3300009975\|Ga0105129_112821	Not Available	593	Open in IMG/M
3300009976\|Ga0105128_110333	Not Available	638	Open in IMG/M
3300009980\|Ga0105135_103881	Not Available	923	Open in IMG/M
3300009980\|Ga0105135_106259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	815	Open in IMG/M
3300009980\|Ga0105135_109307	Not Available	731	Open in IMG/M
3300009981\|Ga0105133_102163	Not Available	1054	Open in IMG/M
3300009992\|Ga0105120_1014737	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	809	Open in IMG/M
3300009995\|Ga0105139_1028453	Not Available	886	Open in IMG/M
3300009995\|Ga0105139_1071504	Not Available	644	Open in IMG/M
3300009995\|Ga0105139_1077156	Not Available	624	Open in IMG/M
3300010371\|Ga0134125_12475040	Not Available	564	Open in IMG/M
3300010396\|Ga0134126_12501181	Not Available	561	Open in IMG/M
3300010400\|Ga0134122_11592112	Not Available	677	Open in IMG/M
3300010403\|Ga0134123_11329626	Not Available	756	Open in IMG/M
3300010403\|Ga0134123_12491779	Not Available	583	Open in IMG/M
3300015270\|Ga0182183_1019859	Not Available	808	Open in IMG/M
3300015280\|Ga0182100_1059664	Not Available	603	Open in IMG/M
3300015280\|Ga0182100_1083774	Not Available	536	Open in IMG/M
3300015280\|Ga0182100_1087503	Not Available	527	Open in IMG/M
3300015284\|Ga0182101_1026545	Not Available	776	Open in IMG/M
3300015290\|Ga0182105_1077621	Not Available	568	Open in IMG/M
3300015293\|Ga0182103_1082484	Not Available	545	Open in IMG/M
3300015297\|Ga0182104_1018453	All Organisms → cellular organisms → Eukaryota → Viridiplantae	932	Open in IMG/M
3300015297\|Ga0182104_1036568	Not Available	758	Open in IMG/M
3300015301\|Ga0182184_1062735	Not Available	594	Open in IMG/M
3300015306\|Ga0182180_1055226	Not Available	611	Open in IMG/M
3300015306\|Ga0182180_1094121	Not Available	505	Open in IMG/M
3300015310\|Ga0182162_1023350	Not Available	907	Open in IMG/M
3300015310\|Ga0182162_1089911	Not Available	578	Open in IMG/M
3300015311\|Ga0182182_1059039	Not Available	653	Open in IMG/M
3300015317\|Ga0182136_1058989	Not Available	699	Open in IMG/M
3300015318\|Ga0182181_1025688	Not Available	835	Open in IMG/M
3300015318\|Ga0182181_1061016	Not Available	628	Open in IMG/M
3300015318\|Ga0182181_1064656	Not Available	616	Open in IMG/M
3300015319\|Ga0182130_1111028	Not Available	546	Open in IMG/M
3300015320\|Ga0182165_1133018	Not Available	525	Open in IMG/M
3300015324\|Ga0182134_1148281	Not Available	502	Open in IMG/M
3300015325\|Ga0182148_1095275	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	594	Open in IMG/M
3300015325\|Ga0182148_1105054	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572	Open in IMG/M
3300015327\|Ga0182114_1023493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	1024	Open in IMG/M
3300015327\|Ga0182114_1050462	Not Available	794	Open in IMG/M
3300015328\|Ga0182153_1049950	All Organisms → cellular organisms → Eukaryota → Viridiplantae	762	Open in IMG/M
3300015328\|Ga0182153_1112821	Not Available	568	Open in IMG/M
3300015329\|Ga0182135_1082715	Not Available	644	Open in IMG/M
3300015331\|Ga0182131_1074663	Not Available	673	Open in IMG/M
3300015331\|Ga0182131_1152969	Not Available	507	Open in IMG/M
3300015332\|Ga0182117_1081002	Not Available	687	Open in IMG/M
3300015332\|Ga0182117_1144150	Not Available	540	Open in IMG/M
3300015332\|Ga0182117_1169994	Not Available	500	Open in IMG/M
3300015333\|Ga0182147_1023468	Not Available	1040	Open in IMG/M
3300015333\|Ga0182147_1041966	Not Available	861	Open in IMG/M
3300015334\|Ga0182132_1058163	Not Available	770	Open in IMG/M
3300015335\|Ga0182116_1050531	Not Available	842	Open in IMG/M
3300015339\|Ga0182149_1074415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	710	Open in IMG/M
3300015339\|Ga0182149_1085154	Not Available	675	Open in IMG/M
3300015340\|Ga0182133_1159476	Not Available	546	Open in IMG/M
3300015349\|Ga0182185_1209729	Not Available	590	Open in IMG/M
3300015350\|Ga0182163_1148393	Not Available	728	Open in IMG/M
3300015350\|Ga0182163_1173019	Not Available	674	Open in IMG/M
3300015350\|Ga0182163_1174002	Not Available	672	Open in IMG/M
3300015350\|Ga0182163_1229998	Not Available	581	Open in IMG/M
3300015350\|Ga0182163_1234616	Not Available	575	Open in IMG/M
3300015350\|Ga0182163_1256435	Not Available	548	Open in IMG/M
3300015350\|Ga0182163_1278522	Not Available	524	Open in IMG/M
3300015352\|Ga0182169_1123283	Not Available	839	Open in IMG/M
3300015352\|Ga0182169_1212044	Not Available	632	Open in IMG/M
3300015352\|Ga0182169_1216690	Not Available	625	Open in IMG/M
3300015353\|Ga0182179_1067883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1013	Open in IMG/M
3300015353\|Ga0182179_1153909	Not Available	718	Open in IMG/M
3300015353\|Ga0182179_1192617	Not Available	647	Open in IMG/M
3300015354\|Ga0182167_1255006	Not Available	632	Open in IMG/M
3300015354\|Ga0182167_1300811	Not Available	569	Open in IMG/M
3300017412\|Ga0182199_1023991	Not Available	1085	Open in IMG/M
3300017412\|Ga0182199_1070053	Not Available	758	Open in IMG/M
3300017421\|Ga0182213_1167436	Not Available	622	Open in IMG/M
3300017421\|Ga0182213_1213152	Not Available	551	Open in IMG/M
3300017439\|Ga0182200_1042593	Not Available	799	Open in IMG/M
3300017693\|Ga0182216_1179364	Not Available	550	Open in IMG/M
3300017693\|Ga0182216_1189894	Not Available	538	Open in IMG/M
3300017694\|Ga0182211_1162114	Not Available	533	Open in IMG/M
3300020023\|Ga0182178_1018337	Not Available	544	Open in IMG/M
3300025922\|Ga0207646_11397583	Not Available	609	Open in IMG/M
3300025923\|Ga0207681_11687259	Not Available	530	Open in IMG/M
3300025961\|Ga0207712_11915345	Not Available	531	Open in IMG/M
3300028056\|Ga0268330_1055888	Not Available	524	Open in IMG/M
3300028058\|Ga0268332_1069082	Not Available	530	Open in IMG/M
3300028143\|Ga0268348_1026578	Not Available	502	Open in IMG/M
3300028150\|Ga0268343_1012003	Not Available	599	Open in IMG/M
3300028152\|Ga0268336_1031430	Not Available	501	Open in IMG/M
3300028153\|Ga0268320_1028937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	510	Open in IMG/M
3300028380\|Ga0268265_11909870	Not Available	601	Open in IMG/M
3300028468\|Ga0268317_1005992	Not Available	632	Open in IMG/M
3300028523\|Ga0268313_1007791	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	663	Open in IMG/M
3300032490\|Ga0214495_1095909	Not Available	685	Open in IMG/M
3300032502\|Ga0214490_1145094	Not Available	536	Open in IMG/M
3300032589\|Ga0214500_1150596	Not Available	663	Open in IMG/M
3300032625\|Ga0214501_1109258	Not Available	882	Open in IMG/M
3300032625\|Ga0214501_1275085	Not Available	533	Open in IMG/M
3300032760\|Ga0314754_1058688	Not Available	600	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.20%
Environmental	Environmental	6.80%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.20%
Terrestrial	Environmental → Terrestrial	6.80%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	77.67%
Unclassified	Host-Associated → Plants → Unclassified	10.68%
Soil	Environmental → Terrestrial → Soil	6.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.91%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.94%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	77.67%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	10.68%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.85%
Loam	Environmental → Terrestrial → Soil → Loam	1.94%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.97%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	77.67%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	10.68%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.97%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	69.90%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	10.68%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	7.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070690_1015657721	3300005330	Switchgrass Rhizosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNDYGMVMAYIS*
Ga0070668_1016073761	3300005347	Switchgrass Rhizosphere	MPVGRIRAFQSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGYGMIMTYVS*
Ga0068859_1017064672	3300005617	Switchgrass Rhizosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS*
Ga0105137_1055871	3300009972	Switchgrass Associated	KISCQDFTESMPAGRIRAFRSKHCPFWINFGYVVPEIKYALKLVELISNNGYGMVMAYVS
Ga0105129_1128211	3300009975	Switchgrass Associated	IESMPDGWIRTIRSKQCLFWVNFGYVVPEIKYAPKLAELIRYNG*
Ga0105128_1103332	3300009976	Switchgrass Associated	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVKTYVS*
Ga0105135_1038812	3300009980	Switchgrass Associated	GKISCQDFTESMPAGRIRAFRSKHCPFWINFGYVVPEIKYALKLVELISNNGYGMVKTYIS*
Ga0105135_1062592	3300009980	Switchgrass Associated	RIWAFRSNQCLFWVNFGYVIPEIKYAPRLVELIRYNGYGMVMTYLS*
Ga0105135_1093071	3300009980	Switchgrass Associated	MPVGWIRASRSKQRPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMT
Ga0105133_1021631	3300009981	Switchgrass Associated	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGYSMVMAYVS*
Ga0105120_10147372	3300009992	Switchgrass Associated	MPVGRTRAFWSKQCPFWLNFGYVVPEIKYTPKLVELIIYNGYGMIMSYVS*
Ga0105139_10284531	3300009995	Switchgrass Associated	MPVGWIQAFRSKQCLFWVNFGYVVPEVKYAPKFVELIS
Ga0105139_10715041	3300009995	Switchgrass Associated	MPVYRTRAFRSKQYPFRLNFGYVAPEINCAPKLVELTRYNGYGM
Ga0105139_10771561	3300009995	Switchgrass Associated	TESMPAGRIRAFRSKHYPFWVNFGYVVPKIKYALKLVELISNNGYGMVKTYIS*
Ga0134125_124750401	3300010371	Terrestrial Soil	MPVGRIQASRTKQRLLGVNFKYVVPGIKYAPKLMELISNNGYDMVMTYIS*
Ga0134126_125011811	3300010396	Terrestrial Soil	MPVCRIRAFQSKQCPFSVNFGYVIPEIKHTPKLVELIS
Ga0134122_115921122	3300010400	Terrestrial Soil	MPVGHIRAFWSKQCPFWFNFGYVVPEIKYAPKLVELISNNSYGMVMTYIS*
Ga0134123_113296261	3300010403	Terrestrial Soil	STVAMPVGRTQAFRSKQCLFWVNFGYVIPEIKYAPKLVELISNNGYGMVITYIS*
Ga0134123_124917791	3300010403	Terrestrial Soil	MPVGRIRAFRSKQCPFWVDFGYVVPEIKYAPKHVKLIR
Ga0182183_10198591	3300015270	Switchgrass Phyllosphere	MPVGQIRAFRYKQCPFWVNFGYVVPEIKYAPKPVKLISNNG
Ga0182100_10596642	3300015280	Switchgrass Phyllosphere	MPVGWIQAFRSKQCLFWVNFGYVVPEVKYAPKFVELISNNGYRMVMPYIS*
Ga0182100_10837741	3300015280	Switchgrass Phyllosphere	MSVGRIRAFWSKQCLFWVNFGCVVPEIKYAPKLVELISNNGYGLYFMKSGGA
Ga0182100_10875031	3300015280	Switchgrass Phyllosphere	MPVGWIRAFRSKQCPFWVNFRYVVPEIKYAPKLVELISNNGYGMVMAYIS*
Ga0182101_10265452	3300015284	Switchgrass Phyllosphere	MLVGLIQAFRSKLCLFWVNFGYVVPEIKYAPKLVELISNNDYGMVMAYIS*
Ga0182105_10776211	3300015290	Switchgrass Phyllosphere	MTVGRIRAFQSKQCPFWVDFGYVVPEIKYTPKLVELIRFDNYGMIMTYVS*
Ga0182103_10824841	3300015293	Switchgrass Phyllosphere	MPVGWTRAFRSKQYPFWVNFGYVVPEIKYAPKLVELIRYNGYGMIMTYVS*
Ga0182104_10184532	3300015297	Switchgrass Phyllosphere	MLVGLIQAFRSKLCLFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS*
Ga0182104_10365681	3300015297	Switchgrass Phyllosphere	GKISCQDSTESMPVGRIRAFRSKQCPFWVNFGYVVPEIKYTPKLVELIRYNGYGMIMTLVS*
Ga0182184_10627351	3300015301	Switchgrass Phyllosphere	MLVGRIRAFWCKQFPFWVNFGYVVSEIKYAPKLVELISNNGYGMVMAHIS*
Ga0182180_10552261	3300015306	Switchgrass Phyllosphere	MPVGRIRAFQSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGYAM
Ga0182180_10941211	3300015306	Switchgrass Phyllosphere	PLDDTGKISCQDSTESIPVGQIRACRSKQCPFWVNFGYIILEIKYAPKLMELISNNGYGMAMTYVS*
Ga0182162_10233502	3300015310	Switchgrass Phyllosphere	SKQCLFWVNFGYVVPEIKYVPKLVELISNSGYGMVMVYIS*
Ga0182162_10899113	3300015310	Switchgrass Phyllosphere	DTSKISCQDSTESMPVGRIRAFQSKQCPFWVNFRYVVPEIKYTPKLVELIKYNGYDMIITYVS*
Ga0182182_10590391	3300015311	Switchgrass Phyllosphere	MPVGQIWASRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS*
Ga0182136_10589892	3300015317	Switchgrass Phyllosphere	MPVGRIRAFQSKQCPFWVNFGYVVPEIKYAPKLVELIRYNVYGMVMAYIS*
Ga0182181_10256881	3300015318	Switchgrass Phyllosphere	MPVGRIWAFRSKPCPFWVNFGYVVPEIKYAPRLVELISNNGYGMVMAYIS*
Ga0182181_10610161	3300015318	Switchgrass Phyllosphere	KPVGRIQAFQSKQRPFWVKFGYIVPEVKQTPKLMELISNNGYGMVRAYIS*
Ga0182181_10646562	3300015318	Switchgrass Phyllosphere	MPVGRARAFRFGKCPFWLNFGYVVLAITYASKLVELIRFDNYGMIMAYVS*
Ga0182130_11110281	3300015319	Switchgrass Phyllosphere	MPVGWTRAFRSKQYPFWVNFGYVVPEIKYAPKLVELIRYNGY
Ga0182165_11330182	3300015320	Switchgrass Phyllosphere	LEWHDFLSLDDTGKISCQDSTESMPVGQIRAFQYKQCLFWVNFGYVVPEIKYASKLVELISNNGYGMVMAYIS*
Ga0182134_11482811	3300015324	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGY
Ga0182148_10952752	3300015325	Switchgrass Phyllosphere	MPVGRVRAFPSKQCVFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS*
Ga0182148_11050541	3300015325	Switchgrass Phyllosphere	MVWILPLHDFGNISCQGSTESMPVGRIRAFWSKQCPFWVDFGYVVPEIKYAPKLMELISNNGYSMVMAYIS*
Ga0182114_10234931	3300015327	Switchgrass Phyllosphere	FLPLDDTGKISCQDSTESMPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGYAMVVAYVS*
Ga0182114_10504621	3300015327	Switchgrass Phyllosphere	MPAGRIRAFRSKQCPFWVNFLYFVPEIKHAPKLVEL
Ga0182153_10499501	3300015328	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVIPEIKYAPNLVELISNNGYGMVMAYIS*
Ga0182153_11128211	3300015328	Switchgrass Phyllosphere	MPIGRARAFWSGNCPFWLNFGYVVPEIKYAPKLVELISNN
Ga0182135_10827152	3300015329	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVILEIEYAPKLVELIRYS
Ga0182131_10746631	3300015331	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAY
Ga0182131_11529691	3300015331	Switchgrass Phyllosphere	IVDVPIGRARAFRSKHCPFWLNFGYVVPETKYTPKLVELIRFDNYGMIMTYVS*
Ga0182117_10810021	3300015332	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFWVNFGYVVPKIKYAPKLVDLISNNGYVMV
Ga0182117_11441501	3300015332	Switchgrass Phyllosphere	MPIGQARVFRSKHYPFLLNFGYVVPEIKYAPKLVELIRFDNNGMLMTYIS*
Ga0182117_11699941	3300015332	Switchgrass Phyllosphere	MPVGRIRASRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVM
Ga0182147_10234681	3300015333	Switchgrass Phyllosphere	MPVGRIRAFQSKQSPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMASIL*
Ga0182147_10419661	3300015333	Switchgrass Phyllosphere	MPVGRARAFWSKHCPFWLNFGYVVPEIKYTPKLVELIRFDNYGMITSYVL*
Ga0182132_10581631	3300015334	Switchgrass Phyllosphere	MPIGWIRAFRSKQYPFWVNFGYVVPEIKYAPKLVELISNNGY
Ga0182116_10505311	3300015335	Switchgrass Phyllosphere	ASRSKQCPFWVNFGYVVPEIKYAPKLVQLISNNGNGMVMAYIS*
Ga0182149_10744152	3300015339	Switchgrass Phyllosphere	AGRIRASRSKQCPFRVNFGYIVPEIKYAPKLVELISNNGYGMVMTYIS*
Ga0182149_10851541	3300015339	Switchgrass Phyllosphere	MPVGQTWAFQSKQCLFWVNFGYVVPEIKYTPKLVELIKYNGYDMIITYVS*
Ga0182133_11594761	3300015340	Switchgrass Phyllosphere	MPVGRIRALRSKQCPLWVNFGYVVPEIKYAPKLVELISNNG
Ga0182185_12097291	3300015349	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPLWVNFGYVIPEIKYAPKLVELISNNGNGMVMA
Ga0182163_11483931	3300015350	Switchgrass Phyllosphere	MPVRRTLAFRSKQCPFWLNFGYVIPEIKYTPKLVKLSRYNGYGMNMSYA
Ga0182163_11730191	3300015350	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFWLNFGYVVPEIKYAPKLMELVNNNGYGMVMAYIS*
Ga0182163_11740021	3300015350	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPDIKYAPKLVELISNNGYGI
Ga0182163_12299981	3300015350	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFWVKFGYVVHEIKYTPKLVELIRYNGYGMIMTYIS*
Ga0182163_12346161	3300015350	Switchgrass Phyllosphere	CQDSTESMPVGRIRVFRSKLCPFWVNFGYVVPETKYAPKLMELISNYGYGMVMAYIS*
Ga0182163_12564351	3300015350	Switchgrass Phyllosphere	MSVGRTRAFRSKQCPFWVNFGYIILEIKYAPKLMELISNNGYGMAM
Ga0182163_12785223	3300015350	Switchgrass Phyllosphere	TESMPVGRIRAFRSKQCPFWVNIGYVVPEIKYAPKLVELISNNGYGMVMVYIS*
Ga0182169_11232832	3300015352	Switchgrass Phyllosphere	MPVGQTRAFQSKQCLFWVNFGYVVPEIKYTPKLVELIKYNGYDMIITYVS*
Ga0182169_12120441	3300015352	Switchgrass Phyllosphere	MPAGRIRASRSKQCPFRVNFGYIVPEIKYAPKLVE
Ga0182169_12166901	3300015352	Switchgrass Phyllosphere	SKQCLFWVNFGYVVPEIKYAPKHVELISNNGYCTFMAYIS*
Ga0182179_10678832	3300015353	Switchgrass Phyllosphere	MDDIGKISWQDSTESMPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLLELISNNGYGMVMTYVS*
Ga0182179_11539091	3300015353	Switchgrass Phyllosphere	MPVGRIWAFRSNQCLFWVNFGYVIPEIKYAPRLVELIRYNGYGMVMTYLS*
Ga0182179_11926171	3300015353	Switchgrass Phyllosphere	MPVGRTRAFRSKQCLFWVNFGYVVPEIKYAPKLVE
Ga0182167_12550061	3300015354	Switchgrass Phyllosphere	MPVGRIWAFRSNQCLFWVNFGYVIPEIKYAPRLVELIRYNGYGMVMTYLS
Ga0182167_13008111	3300015354	Switchgrass Phyllosphere	ESMPVRRIRAFRSKQCPFRVNFGYVVPEIKYAPKLMELISNNGYGMVMAYIP*
Ga0182199_10239911	3300017412	Switchgrass Phyllosphere	IRAFRSKQCPFWVNFGYVVPDIKYAPKLVELISNNGYGIVMAYIS
Ga0182199_10700531	3300017412	Switchgrass Phyllosphere	CQDSTESMPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS
Ga0182213_11674362	3300017421	Switchgrass Phyllosphere	MPVGRTQAFRSKQCLFWVNFGYVIPEIKYAPKLVEPIDIMVMA
Ga0182213_12131521	3300017421	Switchgrass Phyllosphere	MPVARIRAFRSKQCLFWLNFGYVVPEIKYAPKLMELIRYN
Ga0182200_10425931	3300017439	Switchgrass Phyllosphere	GRFRAFRSKQCLFWVNFGHVVLEVKKTPKLVELISNNGYGMVMA
Ga0182216_11793641	3300017693	Switchgrass Phyllosphere	MPVGWTRAFRSKQYPFWVNFGYVVPEIKYAPKLVELIRYNGYGMIMTYVS
Ga0182216_11898941	3300017693	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFRVNFGYVVPEMKYAPKLVELI
Ga0182211_11621141	3300017694	Switchgrass Phyllosphere	SCQDSTKSMPIGWIRAFRSKQYPFWVNFGYVVPEIKYAPKLVELISNNGYDMVMAYIS
Ga0182178_10183372	3300020023	Switchgrass Phyllosphere	MPVGRVRSFPSKQCVFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS
Ga0207646_113975831	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS
Ga0207681_116872591	3300025923	Switchgrass Rhizosphere	MPVGRIRASRSKQCPFWVNFGYVVPEIKYAPKLMELISNNGYGMVMTYIS
Ga0207712_119153451	3300025961	Switchgrass Rhizosphere	MLVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELINNNGFG
Ga0268330_10558881	3300028056	Phyllosphere	MPVGRIRAFQSKQCPFWVNFGYVVPEIKYAPKLVELIRYNGYAMVVAY
Ga0268332_10690821	3300028058	Phyllosphere	TGKISCQDSTESMPVGRIRAFRFKQCPFWVNFGYFVPEIKYAPKHVELISNNGYGMVMIYIS
Ga0268348_10265781	3300028143	Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMTYIS
Ga0268343_10120032	3300028150	Phyllosphere	LDNTGKISCQDSTESMPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMAYIS
Ga0268336_10314302	3300028152	Phyllosphere	MPVGRIRASRSKQCPFWFNFGYVVPEIKYAPKLVELISNNSYGIVMTYI
Ga0268320_10289371	3300028153	Phyllosphere	CQNSTAAMPVGWTRAFRSKQYPFWVNFGYVVPEIKYAPKLVELIRYNGYGMVMTYLS
Ga0268265_119098701	3300028380	Switchgrass Rhizosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLMELIRYNG
Ga0268317_10059922	3300028468	Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGM
Ga0268313_10077911	3300028523	Phyllosphere	ESMSVGRIRAFRSKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMTYIS
Ga0214495_10959091	3300032490	Switchgrass Phyllosphere	MPVGRTRAFRSKQCPFRVNFGYVVPEMKYAPKLVELISNNG
Ga0214490_11450941	3300032502	Switchgrass Phyllosphere	MPVGRIRASRSKQCPFWVNFGYVVPEVKYAPKLVE
Ga0214500_11505961	3300032589	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYTPKLVELISNNGYGLYFM
Ga0214501_11092581	3300032625	Switchgrass Phyllosphere	MPVRQTLAFRSKQCPFWLNFGYIVPEIKYTPKLVKLTRYNGYGR
Ga0214501_12750852	3300032625	Switchgrass Phyllosphere	MLVGRIRAFGFKQCPFWVNFGYVVPEIKYAPKLVELISNNGYGMVMTYLS
Ga0314754_10586881	3300032760	Switchgrass Phyllosphere	MPVGRIRAFRSKQCPFWVNFGYVVPEIKYTPKLVELISNNGYGMVMTYLS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F098412

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences