NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098484

Metagenome Family F098484

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098484
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 71 residues
Representative Sequence GNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Number of Associated Samples 82
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 32.04 %
% of genes near scaffold ends (potentially truncated) 73.79 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (57.282 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland
(40.777 % of family members)
Environment Ontology (ENVO) Unclassified
(77.670 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(89.320 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF10127RlaP 13.59
PF13155Toprim_2 3.88
PF03767Acid_phosphat_B 3.88
PF03796DnaB_C 2.91
PF09414RNA_ligase 2.91
PF02945Endonuclease_7 1.94
PF13662Toprim_4 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2503Predicted secreted acid phosphataseGeneral function prediction only [R] 3.88
COG3700Acid phosphatase, class BInorganic ion transport and metabolism [P] 3.88
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 2.91
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 2.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A57.28 %
All OrganismsrootAll Organisms42.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003814|Ga0007877_1034738Not Available528Open in IMG/M
3300006072|Ga0007881_1084054All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300006101|Ga0007810_1032463All Organisms → Viruses → Predicted Viral1140Open in IMG/M
3300006103|Ga0007813_1067228All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300006103|Ga0007813_1105740Not Available538Open in IMG/M
3300006104|Ga0007882_10066523All Organisms → Viruses → Predicted Viral1423Open in IMG/M
3300006117|Ga0007818_1084378Not Available583Open in IMG/M
3300009518|Ga0116128_1237863Not Available506Open in IMG/M
3300009519|Ga0116108_1245893Not Available523Open in IMG/M
3300009547|Ga0116136_1093001Not Available789Open in IMG/M
3300009548|Ga0116107_1056006All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300009548|Ga0116107_1093256Not Available909Open in IMG/M
3300009548|Ga0116107_1139313All Organisms → cellular organisms → Bacteria → Proteobacteria678Open in IMG/M
3300009549|Ga0116137_1170846Not Available592Open in IMG/M
3300009552|Ga0116138_1016686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2325Open in IMG/M
3300009615|Ga0116103_1071448Not Available930Open in IMG/M
3300009615|Ga0116103_1161307Not Available538Open in IMG/M
3300009616|Ga0116111_1040378All Organisms → cellular organisms → Bacteria → Proteobacteria1415Open in IMG/M
3300009617|Ga0116123_1083749Not Available864Open in IMG/M
3300009618|Ga0116127_1068610Not Available979Open in IMG/M
3300009618|Ga0116127_1069476All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla970Open in IMG/M
3300009618|Ga0116127_1149091Not Available586Open in IMG/M
3300009628|Ga0116125_1098974Not Available778Open in IMG/M
3300009631|Ga0116115_1045788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1171Open in IMG/M
3300009632|Ga0116102_1098950Not Available840Open in IMG/M
3300009634|Ga0116124_1034585All Organisms → cellular organisms → Bacteria → Proteobacteria1544Open in IMG/M
3300009636|Ga0116112_1125570All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300009636|Ga0116112_1189590Not Available571Open in IMG/M
3300009640|Ga0116126_1239824Not Available571Open in IMG/M
3300009641|Ga0116120_1093058Not Available999Open in IMG/M
3300009760|Ga0116131_1034487All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1719Open in IMG/M
3300009762|Ga0116130_1057518Not Available1226Open in IMG/M
3300009762|Ga0116130_1199213Not Available634Open in IMG/M
3300009764|Ga0116134_1301680Not Available551Open in IMG/M
3300013093|Ga0164296_1188159All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter asburiae802Open in IMG/M
3300014152|Ga0181533_1143007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes989Open in IMG/M
3300014158|Ga0181521_10264625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria900Open in IMG/M
3300014162|Ga0181538_10156680Not Available1302Open in IMG/M
3300014200|Ga0181526_10297159Not Available1028Open in IMG/M
3300014495|Ga0182015_10095440Not Available2070Open in IMG/M
3300017925|Ga0187856_1153060Not Available867Open in IMG/M
3300017925|Ga0187856_1303168Not Available550Open in IMG/M
3300017929|Ga0187849_1276429Not Available633Open in IMG/M
3300017931|Ga0187877_1181979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales831Open in IMG/M
3300017935|Ga0187848_10023891All Organisms → Viruses → Predicted Viral3166Open in IMG/M
3300017938|Ga0187854_10134018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1135Open in IMG/M
3300017940|Ga0187853_10246354Not Available822Open in IMG/M
3300017941|Ga0187850_10083059All Organisms → cellular organisms → Bacteria → Proteobacteria1579Open in IMG/M
3300017941|Ga0187850_10285676All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium734Open in IMG/M
3300017941|Ga0187850_10309395Not Available699Open in IMG/M
3300017988|Ga0181520_10619933Not Available748Open in IMG/M
3300017998|Ga0187870_1014458All Organisms → cellular organisms → Bacteria4264Open in IMG/M
3300018004|Ga0187865_1122142Not Available936Open in IMG/M
3300018008|Ga0187888_1224570Not Available738Open in IMG/M
3300018013|Ga0187873_1148358Not Available897Open in IMG/M
3300018014|Ga0187860_1105025Not Available1277Open in IMG/M
3300018014|Ga0187860_1321201Not Available595Open in IMG/M
3300018014|Ga0187860_1323316Not Available592Open in IMG/M
3300018015|Ga0187866_1318395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales542Open in IMG/M
3300018016|Ga0187880_1096657All Organisms → Viruses → Predicted Viral1462Open in IMG/M
3300018017|Ga0187872_10311558Not Available685Open in IMG/M
3300018018|Ga0187886_1083294All Organisms → Viruses → Predicted Viral1371Open in IMG/M
3300018019|Ga0187874_10197387Not Available837Open in IMG/M
3300018019|Ga0187874_10359153Not Available589Open in IMG/M
3300018021|Ga0187882_1149018Not Available953Open in IMG/M
3300018024|Ga0187881_10111843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1224Open in IMG/M
3300018026|Ga0187857_10237599Not Available842Open in IMG/M
3300018033|Ga0187867_10162947All Organisms → Viruses → Predicted Viral1279Open in IMG/M
3300018034|Ga0187863_10237836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1012Open in IMG/M
3300018034|Ga0187863_10673538Not Available584Open in IMG/M
3300018040|Ga0187862_10871681All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300018057|Ga0187858_10630427All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300019082|Ga0187852_1373569Not Available559Open in IMG/M
3300020711|Ga0214237_1015725All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300021137|Ga0214165_1043394All Organisms → Viruses → Predicted Viral1000Open in IMG/M
3300021139|Ga0214166_1045307All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300025381|Ga0208871_1027897All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300025439|Ga0208323_1007145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3048Open in IMG/M
3300025446|Ga0208038_1044341Not Available884Open in IMG/M
3300025446|Ga0208038_1044690Not Available879Open in IMG/M
3300025448|Ga0208037_1051600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria791Open in IMG/M
3300025453|Ga0208455_1092069Not Available586Open in IMG/M
3300025459|Ga0208689_1025327All Organisms → Viruses → Predicted Viral1516Open in IMG/M
3300025459|Ga0208689_1029637Not Available1330Open in IMG/M
3300025460|Ga0208562_1019470All Organisms → Viruses → Predicted Viral1637Open in IMG/M
3300025460|Ga0208562_1082471Not Available648Open in IMG/M
3300025466|Ga0208497_1046885Not Available876Open in IMG/M
3300025469|Ga0208687_1036630Not Available1274Open in IMG/M
3300025477|Ga0208192_1025779All Organisms → cellular organisms → Bacteria → Proteobacteria1347Open in IMG/M
3300025480|Ga0208688_1057933Not Available817Open in IMG/M
3300025576|Ga0208820_1043050All Organisms → Viruses → Predicted Viral1306Open in IMG/M
3300025576|Ga0208820_1050254Not Available1169Open in IMG/M
3300025812|Ga0208457_1084668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales597Open in IMG/M
3300028759|Ga0302224_10203698Not Available784Open in IMG/M
3300029889|Ga0246001_1013084All Organisms → cellular organisms → Bacteria2774Open in IMG/M
3300031884|Ga0316220_1204618Not Available682Open in IMG/M
3300032579|Ga0316228_1221776Not Available609Open in IMG/M
3300032675|Ga0316225_1144119Not Available771Open in IMG/M
3300032676|Ga0316229_1052140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1890Open in IMG/M
3300032676|Ga0316229_1094230All Organisms → Viruses → Predicted Viral1292Open in IMG/M
3300032677|Ga0316227_1137657Not Available906Open in IMG/M
3300032753|Ga0316224_1154868Not Available797Open in IMG/M
3300032753|Ga0316224_1233473Not Available591Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland40.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland31.07%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater9.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater7.77%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.97%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.97%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003814Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006101Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020711Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300021137Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300021139Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300032579Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300032677Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007877_103473823300003814FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL*
Ga0007881_108405433300006072FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0007810_103246323300006101FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0007813_106722813300006103FreshwaterYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0007813_110574023300006103FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR*
Ga0007882_1006652333300006104FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL*
Ga0007818_108437823300006117FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL*
Ga0116128_123786323300009518PeatlandGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116108_124589313300009519PeatlandMPNILNHGNGLEQVLGEYQDHTWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRL*
Ga0116136_109300133300009547PeatlandLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116107_105600633300009548PeatlandLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0116107_109325613300009548PeatlandNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTSAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR*
Ga0116107_113931313300009548PeatlandIMPNILNHGNGLEQVLGEYQDHAWRILFNNPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL*
Ga0116137_117084633300009549PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116138_101668613300009552PeatlandMPNILKHGNGLEQVLGEYQDHTWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSR
Ga0116103_107144833300009615PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0116103_116130733300009615PeatlandLFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0116111_104037813300009616PeatlandGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL*
Ga0116123_108374943300009617PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL*
Ga0116127_106861013300009618PeatlandGLEQVLGEYQDHAWRILFNKPKDAEGCSILTSAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR*
Ga0116127_106947613300009618PeatlandLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLVFTKGKRL*
Ga0116127_114909123300009618PeatlandYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116125_109897433300009628PeatlandMPNILKHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL*
Ga0116115_104578823300009631PeatlandLNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL*
Ga0116102_109895033300009632PeatlandAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116124_103458543300009634PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL*
Ga0116112_112557013300009636PeatlandDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL
Ga0116112_118959013300009636PeatlandAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116126_123982413300009640PeatlandQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116120_109305833300009641PeatlandEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL*
Ga0116131_103448753300009760PeatlandYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLVFTKGKRL*
Ga0116130_105751813300009762PeatlandHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRP*
Ga0116130_119921333300009762PeatlandHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTSAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR*
Ga0116134_130168013300009764PeatlandQDHAWRILFNKTKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0164296_118815933300013093FreshwaterYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0181533_114300743300014152BogLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVGLKFEKSRRL*
Ga0181521_1026462533300014158BogMPNILNHGNGLEQVLGEYQDHAWRILFGKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR*
Ga0181538_1015668023300014162BogMPNILNHGNGLEQVLGEYQDHAWRILFDKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0181526_1029715933300014200BogMNINLLKHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL*
Ga0182015_1009544013300014495PalsaEQVLGKYQDHAWRILFGKPKDADGCSILTPAQSKGYAYYRAAMQTVQALIDAPKPTWVDLVFTKGKRL*
Ga0187856_115306013300017925PeatlandNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRL
Ga0187856_130316813300017925PeatlandQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL
Ga0187849_127642923300017929PeatlandLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187877_118197913300017931PeatlandIMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILIPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187848_1002389143300017935PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVGLKFEKSRRL
Ga0187854_1013401813300017938PeatlandYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187853_1024635433300017940PeatlandGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187850_1008305943300017941PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187850_1028567633300017941PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187850_1030939533300017941PeatlandILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0181520_1061993323300017988BogMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187870_101445833300017998PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187865_112214233300018004PeatlandENIMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIKTVQALIDAPKPIWVDLKFEKSRRL
Ga0187888_122457013300018008PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL
Ga0187873_114835813300018013PeatlandGLEQVLGEYQDHAWRILFNKPKDAEGCSILTSAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR
Ga0187860_110502543300018014PeatlandAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187860_132120123300018014PeatlandEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187860_132331633300018014PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL
Ga0187866_131839523300018015PeatlandLNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187880_109665743300018016PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVGLKFEKSRRL
Ga0187872_1031155823300018017PeatlandLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187886_108329433300018018PeatlandGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187874_1019738723300018019PeatlandMPNILNHGNGLEQVLGEYQDHTWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRL
Ga0187874_1035915313300018019PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNNPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187882_114901823300018021PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDASKPIWVDLKFEKSRRL
Ga0187881_1011184323300018024PeatlandKLRKGISDMPNILNHGNGLEQVLGEYQDHAWRILFDKPKDAEGCSILTPAQSKGYDHYRAAIQTVQALIDAPTPEWVSATGKFVRL
Ga0187857_1023759913300018026PeatlandEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR
Ga0187867_1016294743300018033PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIYAPKPIWVDLKFEKSRRL
Ga0187863_1023783623300018034PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187863_1067353833300018034PeatlandHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0187862_1087168113300018040PeatlandLRKGISDMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187858_1063042713300018057PeatlandLEQVLGEYQNHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0187852_137356923300019082PeatlandMPNILNHGNGLEQVLGEYMEHAWRILLDKPKDAEGCSILTPAQSKGYDHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0214237_101572533300020711FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL
Ga0214165_104339433300021137FreshwaterMPNILNHGNGLEQVLGKYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0214166_104530733300021139FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208871_102789713300025381FreshwaterSENIMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208323_100714513300025439PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWV
Ga0208038_104434133300025446PeatlandSDMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTSAQSKGYAYYRAAIETVQALIDAPTPEWVGATGKFVRLR
Ga0208038_104469033300025446PeatlandDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208037_105160013300025448PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIW
Ga0208455_109206913300025453PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVD
Ga0208689_102532743300025459PeatlandLNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL
Ga0208689_102963723300025459PeatlandMPNILNHGNGLEQVLGEYQDHAWRILFGKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL
Ga0208562_101947013300025460PeatlandLNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208562_108247113300025460PeatlandEYQDHAWRILFGKPKDAEGCSILTPAQSKGYAYYRAAIETVQALIDAPKPIWVDLKFEKSRRL
Ga0208497_104688513300025466FreshwaterWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208687_103663053300025469PeatlandVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL
Ga0208192_102577933300025477PeatlandLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0208688_105793313300025480PeatlandNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPVWVDLKFEKSRRL
Ga0208820_104305033300025576PeatlandMPNVLNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208820_105025413300025576PeatlandHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0208457_108466823300025812PeatlandVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPTPEWVGATGKFVRL
Ga0302224_1020369833300028759PalsaMSPNILKHGNGLEQVLEEYKEHAFRILFKAPKDAEGCAKLTTAQSKGFAYYRSAIQTLQALMDAPKPAWVDVVFTKSTRL
Ga0246001_101308413300029889PeatMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFE
Ga0316220_120461813300031884FreshwaterHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0316228_122177633300032579FreshwaterPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0316225_114411923300032675FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPTPEWVGATG
Ga0316229_105214013300032676FreshwaterLFNKPKDAEGCSILTPAQSKGYAHYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0316229_109423043300032676FreshwaterVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0316227_113765713300032677FreshwaterHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRRL
Ga0316224_115486823300032753FreshwaterMPNILNHGNGLEQVLGEYQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPVWVDLKFEKSRRL
Ga0316224_123347323300032753FreshwaterQDHAWRILFNKPKDAEGCSILTPAQSKGYAYYRAAIQTVQALIDAPKPIWVDLKFEKSRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.