NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F098622

Metatranscriptome Family F098622

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098622
Family Type Metatranscriptome
Number of Sequences 103
Average Sequence Length 152 residues
Representative Sequence MSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Number of Associated Samples 88
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.03 %
% of genes near scaffold ends (potentially truncated) 60.19 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.175 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(97.087 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(98.058 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 6.49%    Coil/Unstructured: 72.08%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.17 %
UnclassifiedrootN/A5.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10106493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1205Open in IMG/M
3300008832|Ga0103951_10185776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis998Open in IMG/M
3300008832|Ga0103951_10347104All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis778Open in IMG/M
3300008998|Ga0103502_10060427All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1296Open in IMG/M
3300008998|Ga0103502_10088145All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1093Open in IMG/M
3300008998|Ga0103502_10209335All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis713Open in IMG/M
3300009025|Ga0103707_10043657All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis782Open in IMG/M
3300018514|Ga0193488_102393All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis729Open in IMG/M
3300018525|Ga0193230_112223All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis541Open in IMG/M
3300018533|Ga0193523_109213All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis662Open in IMG/M
3300018571|Ga0193519_1005080All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1038Open in IMG/M
3300018586|Ga0193498_1002937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1227Open in IMG/M
3300018586|Ga0193498_1009042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis845Open in IMG/M
3300018589|Ga0193320_1014131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis673Open in IMG/M
3300018590|Ga0193114_1005568All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1183Open in IMG/M
3300018598|Ga0192817_1001414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1116Open in IMG/M
3300018604|Ga0193447_1021272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis588Open in IMG/M
3300018609|Ga0192959_1013443All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1142Open in IMG/M
3300018626|Ga0192863_1009386All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1273Open in IMG/M
3300018631|Ga0192890_1033686All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis702Open in IMG/M
3300018638|Ga0193467_1031601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis774Open in IMG/M
3300018641|Ga0193142_1011999All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1111Open in IMG/M
3300018648|Ga0193445_1030430All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis701Open in IMG/M
3300018652|Ga0192993_1012896All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis814Open in IMG/M
3300018653|Ga0193504_1021884All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis678Open in IMG/M
3300018659|Ga0193067_1051485All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis606Open in IMG/M
3300018666|Ga0193159_1010306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1124Open in IMG/M
3300018676|Ga0193137_1009629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1135Open in IMG/M
3300018688|Ga0193481_1037065All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis874Open in IMG/M
3300018688|Ga0193481_1057243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis647Open in IMG/M
3300018688|Ga0193481_1059415All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis629Open in IMG/M
3300018696|Ga0193110_1019472All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis731Open in IMG/M
3300018709|Ga0193209_1031701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis773Open in IMG/M
3300018712|Ga0192893_1061769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis658Open in IMG/M
3300018713|Ga0192887_1008473All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1147Open in IMG/M
3300018713|Ga0192887_1008828All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1132Open in IMG/M
3300018713|Ga0192887_1008829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1132Open in IMG/M
3300018717|Ga0192964_1040995All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1133Open in IMG/M
3300018752|Ga0192902_1083634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis561Open in IMG/M
3300018753|Ga0193344_1022119All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis911Open in IMG/M
3300018782|Ga0192832_1042101All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis623Open in IMG/M
3300018789|Ga0193251_1060919All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1165Open in IMG/M
3300018803|Ga0193281_1041103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis918Open in IMG/M
3300018811|Ga0193183_1097340All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis520Open in IMG/M
3300018819|Ga0193497_1085680All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis571Open in IMG/M
3300018820|Ga0193172_1087573All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis521Open in IMG/M
3300018833|Ga0193526_1036266All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1128Open in IMG/M
3300018836|Ga0192870_1019027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1154Open in IMG/M
3300018836|Ga0192870_1037756All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis833Open in IMG/M
3300018861|Ga0193072_1026636All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1126Open in IMG/M
3300018863|Ga0192835_1069133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis688Open in IMG/M
3300018872|Ga0193162_1074829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis656Open in IMG/M
3300018879|Ga0193027_1026354All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1130Open in IMG/M
3300018882|Ga0193471_1065737All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis694Open in IMG/M
3300018883|Ga0193276_1089275All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis632Open in IMG/M
3300018884|Ga0192891_1107100All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis677Open in IMG/M
3300018901|Ga0193203_10068567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1129Open in IMG/M
3300018902|Ga0192862_1143376All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis567Open in IMG/M
3300018940|Ga0192818_10023074All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1056Open in IMG/M
3300018944|Ga0193402_10123016All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis728Open in IMG/M
3300018949|Ga0193010_10038467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis741Open in IMG/M
3300018957|Ga0193528_10151942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis854Open in IMG/M
3300018958|Ga0193560_10154671All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis730Open in IMG/M
3300018960|Ga0192930_10191589All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis744Open in IMG/M
3300018961|Ga0193531_10155326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis887Open in IMG/M
3300018963|Ga0193332_10159239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis735Open in IMG/M
3300018963|Ga0193332_10163230All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis724Open in IMG/M
3300018964|Ga0193087_10026703All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1571Open in IMG/M
3300018964|Ga0193087_10210497All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis621Open in IMG/M
3300018965|Ga0193562_10059750All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1046Open in IMG/M
3300018966|Ga0193293_10090010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis585Open in IMG/M
3300018974|Ga0192873_10121729All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1121Open in IMG/M
3300018979|Ga0193540_10181620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis584Open in IMG/M
3300018995|Ga0193430_10067230All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis824Open in IMG/M
3300018995|Ga0193430_10140467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis586Open in IMG/M
3300019001|Ga0193034_10076933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis733Open in IMG/M
3300019002|Ga0193345_10127318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis716Open in IMG/M
3300019002|Ga0193345_10128715All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis712Open in IMG/M
3300019018|Ga0192860_10094931All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1104Open in IMG/M
3300019020|Ga0193538_10075622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1243Open in IMG/M
3300019026|Ga0193565_10083125All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1161Open in IMG/M
3300019026|Ga0193565_10194005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis727Open in IMG/M
3300019030|Ga0192905_10142051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis687Open in IMG/M
3300019037|Ga0192886_10205676All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis633Open in IMG/M
3300019039|Ga0193123_10248619All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis699Open in IMG/M
3300019041|Ga0193556_10242768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis518Open in IMG/M
3300019053|Ga0193356_10238724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis641Open in IMG/M
3300019054|Ga0192992_10316281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis543Open in IMG/M
3300019055|Ga0193208_10360375All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis757Open in IMG/M
3300019067|Ga0193459_101783All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis729Open in IMG/M
3300019111|Ga0193541_1078822All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis574Open in IMG/M
3300019115|Ga0193443_1005215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1153Open in IMG/M
3300019130|Ga0193499_1028407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1106Open in IMG/M
3300019150|Ga0194244_10005611All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1191Open in IMG/M
3300019151|Ga0192888_10124243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis847Open in IMG/M
3300030752|Ga0073953_11482389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis713Open in IMG/M
3300031739|Ga0307383_10123468All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1168Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine97.09%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.94%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300018514Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002967 (ERX1782463-ERR1711889)EnvironmentalOpen in IMG/M
3300018525Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000189 (ERX1782203-ERR1712234)EnvironmentalOpen in IMG/M
3300018533Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002107 (ERX1789415-ERR1719338)EnvironmentalOpen in IMG/M
3300018571Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789502-ERR1719425)EnvironmentalOpen in IMG/M
3300018586Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002942 (ERX1782243-ERR1712114)EnvironmentalOpen in IMG/M
3300018589Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001664 (ERX1782130-ERR1711875)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018598Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782248-ERR1712090)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018609Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782449-ERR1712128)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018631Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789487-ERR1719508)EnvironmentalOpen in IMG/M
3300018638Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789495-ERR1719505)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018652Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782207-ERR1711900)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018688Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789672-ERR1719470)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018712Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789456-ERR1719466)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018717Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196)EnvironmentalOpen in IMG/M
3300018728Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789465-ERR1719147)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018753Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789594-ERR1719358)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018789Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001380 (ERX1809763-ERR1740128)EnvironmentalOpen in IMG/M
3300018803Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789721-ERR1719184)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018833Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789510-ERR1719289)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018863Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000581 (ERX1789689-ERR1719283)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018884Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789629-ERR1719186)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018902Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789490-ERR1719234)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018944Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789675-ERR1719391)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018990Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001334 (ERX1782458-ERR1711911)EnvironmentalOpen in IMG/M
3300018991Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789359-ERR1719369)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019002Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789384-ERR1719347)EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019041Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003007EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019130Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002942 (ERX1782241-ERR1712112)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300030752Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1010649323300008832MarineMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL*
Ga0103951_1018577623300008832MarineMSYTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL*
Ga0103951_1034710413300008832MarineMSYAAELSRQETNRRAVSRSRSRNIFYVKKVWREKIFTRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNY
Ga0103502_1006042723300008998MarineVISYSAELSRQETNRRAVSRSRDYTSDYKVARHYNRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGSWKHFNISTETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPAGWARRL*
Ga0103502_1008814533300008998MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL*
Ga0103502_1020933523300008998MarineSSSNSTSTNHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL*
Ga0103707_1004365713300009025Ocean WaterMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRHYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRY
Ga0193488_10239313300018514MarineLSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193230_11222313300018525MarineRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193523_10921313300018533MarineNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDFYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0193519_100508013300018571MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0193498_100293723300018586MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193498_100904213300018586MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYF
Ga0193320_101413113300018589MarineTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193114_100556813300018590MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDFYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0192817_100141413300018598MarineMSYTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193447_102127213300018604MarineDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0192959_101344313300018609MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYAGNKHGSDGLYPCNRDVLGTWKHYNLSAETLNARNNRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRHYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192863_100938633300018626MarineMSYAAELSRQETTRRAVSRSRDYTSDYKVAHHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISASTLDARNTRARSPLQSRELDRYFETRKRVNYIGDCSQGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPSGWGGRRL
Ga0192890_103368613300018631MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIDRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193467_103160113300018638MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVAHHYNIGRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193142_101199923300018641MarineMSYTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193445_103043013300018648MarineHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0192993_101289613300018652MarineMGASPFADRALSVPPSTYTSGFSSSTSTSFSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193504_102188423300018653MarineSDFDCKVMSYTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRHYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193067_105148513300018659MarineISYAAELSRQETTRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193159_101030623300018666MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193137_100962913300018676MarineMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193481_103706513300018688MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVAHHYNIGRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWG
Ga0193481_105724323300018688MarineSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193481_105941513300018688MarineYSAELERQETTRRAVSSRTYTSGSTSTSSVSRNYPVDSYRARYDYYDGNKHGSDGLYPCSRDVLGTWKHSGLSSETLNSRNSRARSPLHTREIDRYFETRKRANYMGDLSSGGSSDFRHYNYRRVPYFGGSDNYTYMKQKPTGWGGARSRF
Ga0193110_101947223300018696MarineRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193209_103170123300018709MarineSNSTSTSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0192893_106176913300018712MarineGYYSDFDCKVMSYSAELERQETTRRAVSSRTYTSGSTSTSSVSRNYPVDSYRARYDYYDGNKHGSDGLYPCSRDVLGTWKHSGLSSETLNSRNSRARSPLHTREIDRYFETRKRANYIGDLSSGGSSDFRHYNYRRVPYFGGSDNYTYMKQKPTGWGGARSRF
Ga0192887_100847313300018713MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192887_100882823300018713MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARQYNTGRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192887_100882923300018713MarineMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192964_104099513300018717MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGTDGLYPCNRDVLGSWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRHYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193333_106182713300018728MarineGYSTSNSTSTSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0192902_108363413300018752MarineSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193344_102211913300018753MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192832_104210113300018782MarineHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNINRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193251_106091913300018789MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYAGNKHGSDGLYPCNRDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193281_104110313300018803MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGG
Ga0193183_109734013300018811MarineSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNSRARSPLRSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193497_108568013300018819MarineSSSSTSSSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193172_108757313300018820MarineSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSMDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193526_103626613300018833MarineMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0192870_101902723300018836MarineMSYAAELSRQETTRRAVSRSRDYTSDYKVAHHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISASTLDARNTRARSPLQSRELDRYFETRKRVNYIGDCSQGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPSGWGSRRL
Ga0192870_103775613300018836MarineMSYAAELSRQETTRRAVSRSRDYTSDYKVAHHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISASTLDARNTRARSPLQSRELDRYFETRKRVNYIGDCSQGGTSDFRYYNYRRVPYFG
Ga0193072_102663613300018861MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192835_106913313300018863MarineSSSGSTSSSHYSDFDCKVISYAAELSRQETTRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193162_107482913300018872MarineRRAVSRSRDYTSDYKVARQYNTGRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193027_102635413300018879MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRKL
Ga0193471_106573713300018882MarineETVRHSVSRSRDYTSDYKVTRHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCNRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193276_108927513300018883MarineELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0192891_110710013300018884MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFG
Ga0193203_1006856713300018901MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192862_114337613300018902MarinePPSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0192818_1002307413300018940MarineMSYTAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193402_1012301623300018944MarineSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193010_1003846723300018949MarineMGSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCNRDVLGTWKHYNLSSGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193528_1015194213300018957MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFG
Ga0193560_1015467113300018958MarineASSSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192930_1019158913300018960MarineMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRV
Ga0193531_1015532613300018961MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARQYNTGRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYF
Ga0193332_1015923923300018963MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLNARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193332_1016323013300018963MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193087_1002670323300018964MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193087_1021049713300018964MarineDYYDGNKHGSDGLYPCNKGRTLLDHILVELKEMMPEEDWARMRDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193562_1005975013300018965MarineMSYAAELSRQETNRRAVSRSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193293_1009001013300018966MarineTSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0192873_1012172923300018974MarineDFDCKVMSYAAELSRQETTRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISASTLDARNTRARSPLQSRELDRYFETRKRVNYIGDCSQGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPSGWGGRRL
Ga0193540_1018162013300018979MarineYKVARHYNISRNYPEDSFSSRYDFYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0193126_1017126513300018990MarineYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192932_1030551513300018991MarineDFHYTDFDCKVLDYSAQLDRQETARNFVSQTRNYTSDYLSESRHSRRDYPSDSFRARYDYYSGNKHGSDGIYPCANEVLGSWKHFNKSAETLNTRNSRAKSPLVSRELNRYYETRKRANYIGDVSSGGACDFRYYNYRLVPYFGGSDNYTYMKQRPFVRRN
Ga0193430_1006723013300018995MarineSSNSTSTSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193430_1014046713300018995MarineHYSDFDCKVMSYAAELSRQETNRRAVSRSREYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSMDVLGTWKHYNISAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193034_1007693313300019001MarineMGQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193345_1012731813300019002MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193345_1012871523300019002MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192860_1009493113300019018MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNSRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193538_1007562213300019020MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDFYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193565_1008312513300019026MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0193565_1019400513300019026MarineSHYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSARYDYYDGNKHGSDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0192905_1014205113300019030MarineYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192886_1020567613300019037MarineTRRAVSSRTYTSGSTSTSSVSRNYPVDSYRARYDYYDGNKHGSDGLYPCSRDVLGTWKHSGLSSETLNSRNSRARSPLHTREIDRYFETRKRANYMGDLSSGGSSDFRHYNYRRVPYFGGSDNYTYMKQKPTGWGGARSRF
Ga0193123_1024861913300019039MarineTVRHSVSRSRDDTSDYKVARHYNLERNYPEYSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKSTGWNGGRRL
Ga0192857_1019127513300019040MarineVSRSRDYTTDYKVARHYNITRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETQKRVNYIGDCSAGGASDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193556_1024276813300019041MarineYSDFDCKVMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNINRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193455_1019658113300019052MarineMTDSHYTDFDCKVMAYSAQLDLQETARQSVSQARYLPYQSMAHRRTRDYPSDSFSARYDYYAGNKHGTDGLYPCSREVLGTWKHYNLSAETLNARNSRARSPLISRELDRYYETKKRSNYIGEISMGGACDFRYYNYRKVPYFGGSDDYCYMKQKPGARRV
Ga0193356_1023872413300019053MarineYAAELSRQETNRRAVSQSRDYTSDYKVARHYNIDRNYPEDSFSSRYDYYHGNKHGSDGLYPCNKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0192992_1031628113300019054MarineSRDYTSDYKVARHYNRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGSWKHFNISTETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPAGWARRL
Ga0193208_1036037513300019055MarineVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193459_10178313300019067MarineELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193541_107882213300019111MarineVMSYAAELSRQETNRRAVSRSRDYTSDYKVARQYNTGRNYPEDSFSSRYDYYDGNKHGSDGLYPCSKDVLGTWKHYNLSAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0193443_100521513300019115MarineMQLSRQETNRRAVSRSSRDYTTDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGARRL
Ga0193436_103438113300019129MarineTSNSTSTSHYSDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNLERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0193499_102840723300019130MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNINRNYPEDSFSARYDYYDGNKHGSDGLYPCSKDVLGTWKHYNISAETLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGARRL
Ga0194244_1000561123300019150MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARQYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQKPTGWGGRRL
Ga0192888_1012424313300019151MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNISRNYPEDSFSSRYDYYDGNKHGTDGLYPCNKDVLGTWKHYNISAETLNARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRYYNYRRVPYFGGSDNYQYMKQ
Ga0073953_1148238923300030752MarineDFDCKVMSYAAELSRQETVRHSVSRSRDYTSDYKVARHYNIERNYPEDSFSARYDYYAGDKHGSDGLYPCSRDVLGTWKHYNLSAGTLAARNTRARSPLQSRELDRYFETRKRVNYIGDCSAGGAVDFRHYNYRRVPYFGGSDNYQYMKQKPTGWNGGRRL
Ga0307383_1012346813300031739MarineMSYAAELSRQETNRRAVSRSRDYTSDYKVARHYNIGRNYPEDSFSSRYDYYAGNKHGTDGLYPCNRDVLGTWKHYNLSAETLNARNNRARSPLQSRELDRYFETRKRVNYIGDCSAGGTSDFRHYNYRRVPYFGGSDNYQYMKQKPTGWGARRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.