NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098745

Metagenome / Metatranscriptome Family F098745

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098745
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 50 residues
Representative Sequence MKKLFAKDKENRKTIKQSELKHFILKQISTNSNFLKTTRWNALYKLS
Number of Associated Samples 84
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.50 %
% of genes near scaffold ends (potentially truncated) 99.03 %
% of genes from short scaffolds (< 2000 bps) 97.09 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.058 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(52.427 % of family members)
Environment Ontology (ENVO) Unclassified
(57.282 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.553 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.00%    β-sheet: 0.00%    Coil/Unstructured: 40.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00329Complex1_30kDa 91.26
PF00416Ribosomal_S13 4.85
PF00361Proton_antipo_M 3.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0852NADH:ubiquinone oxidoreductase 27 kD subunit (chain C)Energy production and conversion [C] 91.26
COG3262Ni,Fe-hydrogenase III component GEnergy production and conversion [C] 91.26
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 4.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003307|Ga0006883J46559_1036156All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica691Open in IMG/M
3300004798|Ga0058859_10925157All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300005419|Ga0068883_1425394All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica808Open in IMG/M
3300005982|Ga0075156_10635049All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica536Open in IMG/M
3300006056|Ga0075163_11109507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica800Open in IMG/M
3300007228|Ga0075175_1477308All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica678Open in IMG/M
3300007235|Ga0075184_11049268All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica634Open in IMG/M
3300007242|Ga0075172_1515643All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica645Open in IMG/M
3300007242|Ga0075172_1554503All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica558Open in IMG/M
3300007248|Ga0075168_1611552All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica542Open in IMG/M
3300008044|Ga0099804_1667955All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica617Open in IMG/M
3300008105|Ga0114338_1010544All Organisms → cellular organisms → Eukaryota5614Open in IMG/M
3300008929|Ga0103732_1058749All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica593Open in IMG/M
3300008930|Ga0103733_1054339All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica635Open in IMG/M
3300008931|Ga0103734_1049580All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica639Open in IMG/M
3300008933|Ga0103736_1036708All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica640Open in IMG/M
3300008935|Ga0103738_1038549All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica665Open in IMG/M
3300008936|Ga0103739_1044201All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica621Open in IMG/M
3300008936|Ga0103739_1051695All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica578Open in IMG/M
3300008938|Ga0103741_1058676All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica748Open in IMG/M
3300009080|Ga0102815_10357971All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica809Open in IMG/M
3300009195|Ga0103743_1049524All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica623Open in IMG/M
3300009216|Ga0103842_1048760All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica522Open in IMG/M
3300009436|Ga0115008_11354887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica546Open in IMG/M
3300009543|Ga0115099_10883854All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica680Open in IMG/M
3300009599|Ga0115103_1235574All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica681Open in IMG/M
3300009606|Ga0115102_10004758All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica677Open in IMG/M
3300009606|Ga0115102_10175332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica680Open in IMG/M
3300009677|Ga0115104_11282473All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica746Open in IMG/M
3300009730|Ga0123359_192171All Organisms → cellular organisms → Eukaryota → Sar1349Open in IMG/M
3300009747|Ga0123363_1054649All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica662Open in IMG/M
3300012782|Ga0138268_1183043All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica667Open in IMG/M
3300012954|Ga0163111_10487920All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica1133Open in IMG/M
3300012954|Ga0163111_10840706All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica877Open in IMG/M
3300012962|Ga0129335_1139822All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica691Open in IMG/M
3300018593|Ga0192844_1011462All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica704Open in IMG/M
3300018603|Ga0192881_1015233All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica743Open in IMG/M
3300018616|Ga0193064_1017646All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica647Open in IMG/M
3300018618|Ga0193204_1015205All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica589Open in IMG/M
3300018625|Ga0192842_1019062All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica733Open in IMG/M
3300018711|Ga0193069_1020600All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica734Open in IMG/M
3300018713|Ga0192887_1025750All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica764Open in IMG/M
3300018713|Ga0192887_1028349All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica733Open in IMG/M
3300018730|Ga0192967_1050087All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica699Open in IMG/M
3300018730|Ga0192967_1085694All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica508Open in IMG/M
3300018782|Ga0192832_1046122All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica598Open in IMG/M
3300018791|Ga0192950_1034654All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica722Open in IMG/M
3300018813|Ga0192872_1056845All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica694Open in IMG/M
3300018844|Ga0193312_1037157All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica680Open in IMG/M
3300018860|Ga0193192_1028344All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica700Open in IMG/M
3300018927|Ga0193083_10044985All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica639Open in IMG/M
3300018934|Ga0193552_10146655All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica672Open in IMG/M
3300018947|Ga0193066_10032085All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1361Open in IMG/M
3300018974|Ga0192873_10283452All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica709Open in IMG/M
3300018980|Ga0192961_10142447All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica730Open in IMG/M
3300018980|Ga0192961_10182536All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica634Open in IMG/M
3300018982|Ga0192947_10146275All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica789Open in IMG/M
3300018982|Ga0192947_10158237All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica755Open in IMG/M
3300018982|Ga0192947_10162795All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica743Open in IMG/M
3300018982|Ga0192947_10200082All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica657Open in IMG/M
3300019009|Ga0192880_10000520All Organisms → cellular organisms → Bacteria4163Open in IMG/M
3300019010|Ga0193044_10193674All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica648Open in IMG/M
3300019021|Ga0192982_10208598All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica697Open in IMG/M
3300019021|Ga0192982_10235933All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica655Open in IMG/M
3300019022|Ga0192951_10219700All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica702Open in IMG/M
3300019022|Ga0192951_10263716All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica646Open in IMG/M
3300019031|Ga0193516_10262083All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica560Open in IMG/M
3300019036|Ga0192945_10059701All Organisms → cellular organisms → Eukaryota → Sar1124Open in IMG/M
3300019036|Ga0192945_10101452All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica905Open in IMG/M
3300019036|Ga0192945_10167057All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica709Open in IMG/M
3300019040|Ga0192857_10135403All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica734Open in IMG/M
3300019045|Ga0193336_10026253All Organisms → cellular organisms → Eukaryota → Sar1276Open in IMG/M
3300019045|Ga0193336_10290507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica713Open in IMG/M
3300019045|Ga0193336_10357297All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica664Open in IMG/M
3300019048|Ga0192981_10235112All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica706Open in IMG/M
3300019049|Ga0193082_10827400All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica521Open in IMG/M
3300019050|Ga0192966_10200553All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica713Open in IMG/M
3300019053|Ga0193356_10184938All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica732Open in IMG/M
3300019103|Ga0192946_1037432All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica730Open in IMG/M
3300019103|Ga0192946_1037935All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica725Open in IMG/M
3300019103|Ga0192946_1038098All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica723Open in IMG/M
3300019123|Ga0192980_1058715All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica728Open in IMG/M
3300019129|Ga0193436_1048630All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica663Open in IMG/M
3300019133|Ga0193089_1144468All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica529Open in IMG/M
3300020203|Ga0163148_10517961All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica542Open in IMG/M
3300021266|Ga0210348_147634All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica624Open in IMG/M
3300021269|Ga0210356_178928All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica593Open in IMG/M
3300021294|Ga0210325_1233659All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica660Open in IMG/M
3300021298|Ga0210349_1224039All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica524Open in IMG/M
3300021304|Ga0210331_1015001All Organisms → cellular organisms → Eukaryota → Sar2633Open in IMG/M
3300021316|Ga0210351_1353718All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica511Open in IMG/M
3300021947|Ga0213856_1092697All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica643Open in IMG/M
3300022384|Ga0210321_1047507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica600Open in IMG/M
3300024343|Ga0244777_10714509All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica598Open in IMG/M
3300027776|Ga0209277_10277970All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica685Open in IMG/M
3300027833|Ga0209092_10106153All Organisms → cellular organisms → Eukaryota → Sar1660Open in IMG/M
3300027833|Ga0209092_10600481All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica550Open in IMG/M
3300027883|Ga0209713_10346889All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica984Open in IMG/M
3300030537|Ga0247642_1017669All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica649Open in IMG/M
3300030599|Ga0247630_1194871All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica536Open in IMG/M
3300031212|Ga0307959_1089798All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica809Open in IMG/M
3300031222|Ga0307972_1214667All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica529Open in IMG/M
3300031395|Ga0307957_1047715All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica908Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine52.43%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.74%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica8.74%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent7.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.83%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.91%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.97%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.97%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.97%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.97%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.97%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.97%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.97%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.97%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003307Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005419Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300007228Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007235Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 D RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007242Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007248Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 D RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300008044Coral microbial communities from Puerto Morelos, Mexico - Orbicella C A metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008105Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, sample E2014-0046-100-LTREnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009730Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018593Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000600 (ERX1782171-ERR1712017)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300020203Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2EnvironmentalOpen in IMG/M
3300021266Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.458 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021269Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021294Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.264 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021298Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021304Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.300 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021316Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022384Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030537Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031212Saline water microbial communities from Organic Lake, Antarctica - #494EnvironmentalOpen in IMG/M
3300031222Saline water microbial communities from Organic Lake, Antarctica - #780EnvironmentalOpen in IMG/M
3300031395Saline water microbial communities from Organic Lake, Antarctica - #490EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0006883J46559_103615623300003307FreshwaterMKKLFAKDKEKRQSVKQKELKHFVLKQISTNANFIKTVRWNALYELNS
Ga0058859_1092515713300004798Host-AssociatedMKKIFTKDIKNRKTVKQFELEHFILNQIYTNSNFIKLLRWNALDKLNKLPKKSSKALISN
Ga0068883_142539423300005419Freshwater LakeMKKLFAKDRENRQVAKQLELKHFVLKQISTNSNFVKTARWNALYELIHSKQGSKTVLSNRCVKT
Ga0075156_1063504913300005982Wastewater EffluentMKKLFAKDQENRQVVKQLELKHFILKQISTNSNFVKTARWNALYELIHSKQGSKTV
Ga0075163_1110950723300006056Wastewater EffluentMKKLFAKDRENRQITKQLELKHFVLKQIATNSNIIKTARWNALYQL
Ga0075175_147730813300007228Wastewater EffluentMKKLFAKDRENRQVVKQLELKHFILKQISTNSNFVKTARWNALYELIHSK
Ga0075184_1104926823300007235Wastewater EffluentMKKLFAKDRENRQVANQLELKHFVLKQISTNSNFVKTARWNALYELIHSKQGSKTVLSNRCI
Ga0075172_151564323300007242Wastewater EffluentMKKLFAKDRENRQITKQLELKHFVLKQIATNSNIIKTARWNALYQLAYYKKGSKT
Ga0075172_155450323300007242Wastewater EffluentMKKLFAKDRENRKTIKQFELEHFILKQILTNSNFLKTTRWNALSRLYGLSNKSSKTYVSNRCVQT
Ga0075168_161155223300007248Wastewater EffluentMKKLFAKDRENRQVVKQLELKHFILKQISTNSNFVKTARWNALYELIH
Ga0099804_166795513300008044CoralMKKIFSKDKKNRVSTKNTELQHFILKQISNDLNFSKTIN
Ga0114338_1010544103300008105Freshwater, PlanktonMKKLFAKDRENRKNIKQLELEHFILKQISTNSNLLKPIRWN
Ga0103732_105874913300008929Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYTLSNTKL
Ga0103733_105433923300008930Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYKLSNISRNSSKTPLKHKVTRF
Ga0103734_104958023300008931Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYKLSDI
Ga0103736_103670823300008933Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDKENRKTIKQSELKHFILKQISTNSNFLKTTRWNALYKLSNISKKNSKTII
Ga0103738_103854923300008935Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYKLSNISRNSSKTASQT
Ga0103739_104420113300008936Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDKENRKTIKQSELKHFILKQISTNSNFLKTTRWNALYKLSNISKKNSKTIISKRCILTTNKK
Ga0103739_105169523300008936Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALC
Ga0103741_105867613300008938Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYKLSNISRNSSKTVHLKHKV
Ga0102815_1035797133300009080EstuarineMKKLFAKDRENRQVVKQLELKHFILKQISTNSNFIKTAR
Ga0103743_104952423300009195Ice Edge, Mcmurdo Sound, AntarcticaMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLRTTRWNALYKLSNISRNSSKTGPQTQS
Ga0103842_104876013300009216River WaterLGNFGVKVKDMKKLFVKDKKNRKTIKQSELKHFVLKQISTNSNFLKTTRWNALYKLSNISKKILRQLFQI
Ga0115008_1135488713300009436MarineMKKLFAKDRRNRKIVKQLELKNFILKQISTNSNFLKTTRWNALSKLSDISENSSKTII
Ga0115099_1088385413300009543MarineMKKLFAKDRKNRKIVKELELKRFILKQISTNSNFLKTTRWN
Ga0115103_123557423300009599MarineMKKLFAKDRKNRKIVKELELKRFILKQISTNSNFLKTTRWNALHKLSSLSS
Ga0115102_1000475823300009606MarineMKKLFAKDRKNRKIVKELELKRFILKQISTNSNFLKTTRWNA
Ga0115102_1017533213300009606MarineMKKLFAKDKRNRKIVKQLELKHFILKQISTNSNFLKTTRR
Ga0115104_1128247313300009677MarineMKKLFAKDRRNRELVKQLELKHFILKQISTNSNFLRTTRWNALHKLANMSKTNSKTIISN
Ga0123359_19217113300009730MarineMKKLFAKDRRNRKIVKQLELKNFILKQISTNSNFLKTTRWNALSKLSDISENSSKTVISN
Ga0123363_105464923300009747MarineMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLKTTRWNALYK
Ga0138268_118304323300012782Polar MarineMKKLFAKDRRNRKIIKQLELKHFILKQISTNSNFIKTTR
Ga0163111_1048792013300012954Surface SeawaterMKKLFVKDRKNRKNIKQSELKHFILKQISTNSNFFKI
Ga0163111_1084070623300012954Surface SeawaterMKKLFAKDRRNRELVKQLELKHFILKQISTNSNFLRTTRWNALHKLANMS
Ga0129335_113982223300012962AqueousMKKLFAKDRENRKTIRQFELEHFVLKQISTNFNFLRTIRWNALY
Ga0192844_101146223300018593MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTIR
Ga0192881_101523323300018603MarineMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTIRWNALHKLSTISKK
Ga0193064_101764623300018616MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTIRWNALYKLSNIS
Ga0193204_101520513300018618MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTVR
Ga0192842_101906223300018625MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTVRWNALYKLSNI
Ga0193069_102060023300018711MarineVGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTIRWNALYKLSNI
Ga0192887_102575013300018713MarineMKKLLVKDKKNRKIIKQAELKHFILKQISTNFNFLKTIRWNALHQLSNTSKKNS
Ga0192887_102834913300018713MarineMKKLVAKDKKNRKIIKQSELKHFILKQISTNSNFLKTVRWNALHKLSNI
Ga0192967_105008723300018730MarineLGNSRIKLKYMKKLFAKDKKNRKTIKRSELKHFVLKQISTNANFLKIIRWNALYKI
Ga0192967_108569413300018730MarineMKKLFAKDKKNRKTIKQSELKHFVLKQISTNANFLKTIRWNALYK
Ga0192832_104612213300018782MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTVRWNALYTLSNIS
Ga0192950_103465423300018791MarineMKKLFAKDRRNRKIVKQLELKHFVLKQISTNSNFLKTTRWNALHK
Ga0192872_105684513300018813MarineMKKLVAKDKKNRKIIKQSELKHFILKQISTNSNFLK
Ga0193312_103715713300018844MarineMKKLFTKDKENRKTIKQSELKHFVLKQISTNSNFLKTIRWNALYKLSNT
Ga0193192_102834413300018860MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTV
Ga0193083_1004498513300018927MarineMKKLLVKDRKNRKIIKQAELKHFIFKQISTNFNFLKTIRWNALHQLSNTS
Ga0193552_1014665523300018934MarineVGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTIRWNALYKLS
Ga0193066_1003208513300018947MarineMKKLFVKDRKNRKNIKQSELKHFILKQISTNSNFF
Ga0192873_1028345213300018974MarineMKKLVAKDKKNRKIIKQSELKHFILKQISTNSNFLKTVRWN
Ga0192961_1014244723300018980MarineMKKLFAKDRKNRKIVKELELKRFILKQISTNSNFLKTTRWNALHKLSS
Ga0192961_1018253613300018980MarineMKKLFAKDSKNRKIVKELELKHFILKQISTNSNFLRTTRWNALHKLSSLSK
Ga0192947_1014627523300018982MarineMKKLFAKDRRNRKIVKQLELKHFVLKQISTNSNFLKTTRWNALHKLSNISKNASKTVIS
Ga0192947_1015823723300018982MarineMKKLFAKDRRNRKTVKQLELKHFILKQISTNSNFLKTTRWNALYK
Ga0192947_1016279513300018982MarineLGNFGVKLKDMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTTRWNALYKLSNIS
Ga0192947_1020008223300018982MarineLGNFRIKLKYMKKLFAKDKKNRKTIKRSELKHFVLKQISTNANFLKIIRWNALYKTSDIV
Ga0192880_1000052073300019009MarineMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTIRWNALHKLSTISKKNSKTMISN
Ga0193044_1019367423300019010MarineVGNFRIELKYMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFLKTIRWNALYKLSNIS
Ga0192982_1020859813300019021MarineMKKLFAKDRKNRKTIKQSELKHFILKQISTNSNFLKT
Ga0192982_1023593323300019021MarineMKKLFAKDKENRKTIKQSELKHFILKQISTNSNFL
Ga0192951_1021970023300019022MarineMKKLFAKDRRNRKIVKQLELKHFVLKQISTNSNFLKTTR
Ga0192951_1026371613300019022MarineLGNFGVKLKDMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTTRWNALY
Ga0193516_1026208323300019031MarineVGNFRIELKPMKKLFAKDRENRKTIKQSELKHFVLKQISTNS
Ga0192945_1005970113300019036MarineMKKLFVKDKKNRKTIKQSELKHFILKQISTNSNFLRTTRWNALHKLSNISKKKKK
Ga0192945_1010145213300019036MarineLGNFRIKLKYMKKLFAKDKKNRKTIKRSELKHFVLKQISTNANFLKIIRWNALYKTSDIAKKKF
Ga0192945_1016705713300019036MarineMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTIRWN
Ga0192857_1013540313300019040MarineMKKLLIKDKKNRRIIKQSELKHFILKQISTNSNFLKTIRWNALHKLSNI
Ga0193336_1002625313300019045MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTIRWNALYKLSNISKKKKK
Ga0193336_1029050723300019045MarineLGNFGIKLKYMKKLFVKDKKNRKTIKQSELKHFILKQISTNSNFLKTTRWNA
Ga0193336_1035729713300019045MarineMKKLFVKDKKNRKIIKQYELKHFVLKQISTNSNFLKSTRWNALYKL
Ga0192981_1023511213300019048MarineMKKLFAKDRKNRKTIKQSELKHFILKQISTNSNFLKTIR
Ga0193082_1082740013300019049MarineMKKLFVKDKKNRKIIKQSELKHFILKQIATNSNFLKTTR
Ga0192966_1020055313300019050MarineMKKLFAKDKKNRKTIKQSELKHFVLKQISTNANFLKTIRWNA
Ga0193356_1018493813300019053MarineMKKLFVKDRKNRKNIKQSELKHFILKQISTNSNFFKIIRWNALYKLSS
Ga0192946_103743213300019103MarineMKKLFVKDKKNRKTIKQSELKHFILKQISTNSNFLRTTRWNALHKLSN
Ga0192946_103793513300019103MarineMKKLFVKDRKNRKTIKQSELKHFVLKQISTNSNFLKTIRWNALHKL
Ga0192946_103809823300019103MarineLGNFGVKLKDMKKLFVKDKKNRKTIKQSELKHFVLKQISTNSNFLKTTRWNALYK
Ga0192980_105871513300019123MarineMKKLFAKDKENRKTIKQSELKHFILKQISTNSNFLKTTRWNALYKLS
Ga0193436_104863023300019129MarineLGNFRIELKHMKKLFAKDRENRKTIKQSELKHFVLKQISTNSNFIKTVRWNALYKLSNIS
Ga0193089_114446813300019133MarineMKKLFAKDKKNRKIIKQSELKHFVLKQISTNANFLKTIRWNALYKISDISKKNSKTIISKRCI
Ga0163148_1051796123300020203Freshwater Microbial MatMKKLFAKDKQHRKCIKQLELKKFILKQISTNFNFLKTIQWNALHKLSILPKTHSKVILSNRCIL
Ga0210348_14763423300021266EstuarineLGDFRIKLEPMKKLFAKDQENRKTVKQLELEHFILKQISTNSNFLRTTRWNALYKLSNMQ
Ga0210356_17892813300021269EstuarineMKKIFAKDKKNRDTVKQLELKHFVLKQIYNDSNFSKITIWNSLNKLTHLNKRS
Ga0210325_123365923300021294EstuarineMKKLFAKDQKNRKTIKQLELDHFVLKQISTNSNFLK
Ga0210349_122403923300021298EstuarineMKKIFAKDKKNRNTIKHLELKHFILKQISNDSNFSKI
Ga0210331_101500113300021304EstuarineMKKLFAKDQKNRQIVKKLELKNFILKQISANSNFSRTTQWNALSKLSSLTKKRSK
Ga0210351_135371813300021316EstuarineMKKLFAKDKENRQSVKQLELKQFILKQISTNSNFIKTVRWNALYELNCTKE
Ga0213856_109269723300021947WatershedsMKKIFAKDKKNRNTVKQLELKHFVLKQIYNDSNFSKITIWNSLNKL
Ga0210321_104750723300022384EstuarineMKKLFAKDQKNRKTIKQLELDHFVLKQISTNSNFLKTIRWNALYKLSSLSKQSSKTVLSN
Ga0244777_1071450913300024343EstuarineMKKLFAKDRENRQVVKQLELKHFILKQISTNSNFIKTARWNALYELIHSKQ
Ga0209277_1027797023300027776Wastewater EffluentMKKLFAKDRENRQLTKELELKHFVLKQISTNSNFIKTARWNALYELA
Ga0209092_1010615313300027833MarineMKKLFAKDRRNRKIVKQLELKHFILKQISTNSNFLKTTRWNALHKLS
Ga0209092_1060048123300027833MarineMKKLFAKDRRNRKIVKQLELKNFILKQISTNSNFLKTTRWNALSKLSDISENSSKTIIS
Ga0209713_1034688933300027883MarineMKKLFVKDKQNRKTIKQSELKHFVLKQISTNSNFLKTIRWNALHKLSN
Ga0247642_101766923300030537SoilMKKILAKDIKNRKKVKQSELEHFILKQIYANSNFLKMLRWNALDKLSK
Ga0247630_119487113300030599SoilMKKIASKDRTNRKIIKQFELEHFILKQISTNSNFIKMLKWNALDKLNKLPNR
Ga0307959_108979813300031212Saline WaterMKKLFAKDQKNRQIVKKLELKNFILKQISANSNFSRTTQWN
Ga0307972_121466713300031222Saline WaterMKKLFAKDQKNRQIVKKLELKNFILKQISANSNFSRTTQWNALSKLSSLTKRRSKTVLSN
Ga0307957_104771513300031395Saline WaterMKKLFAKDQKNRQIVKKLELKNFILKQISANSNFSRTT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.