Metagenome Family F098772

Basic Information
Family ID	F098772
Family Type	Metagenome
Number of Sequences	103
Average Sequence Length	35 residues
Representative Sequence	MKEETLKMESIEDEAWKKHATHRGDLSQPNPRDE
Number of Associated Samples	7
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	12.75 %
% of genes near scaffold ends (potentially truncated)	15.53 %
% of genes from short scaffolds (< 2000 bps)	48.54 %
Associated GOLD sequencing projects	6
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Eukaryota (58.252 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules (86.408 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.32% β-sheet: 0.00% Coil/Unstructured: 59.68%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF00078	RVT_1	2.94
PF10551	MULE	1.96
PF09337	zf-H2C2	1.96
PF13976	gag_pre-integrs	1.96
PF14223	Retrotran_gag_2	0.98
PF02892	zf-BED	0.98
PF00665	rve	0.98
PF00385	Chromo	0.98
PF03732	Retrotrans_gag	0.98
PF02992	Transposase_21	0.98
PF08284	RVP_2	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.98
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.98
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.98
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.14 %
Unclassified	root	N/A	37.86 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.14 %
Unclassified	root	N/A	37.86 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	58.25 %
Unclassified	root	N/A	37.86 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.88 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	57.28 %
Unclassified	root	N/A	37.86 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.88 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	57.28 %
Unclassified	root	N/A	37.86 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.88 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	57.28 %
Unclassified	root	N/A	37.86 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.88 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	57.28 %
Unclassified	root	N/A	37.86 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	3.88 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	46.60 %
Unclassified	root	N/A	37.86 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	3.88 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	46.60 %
Unclassified	root	N/A	37.86 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	3.88 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	46.60 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis complex	species group	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex	3.88 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	46.60 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	45.63 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %

Name	Rank	Taxonomy	Distribution
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	38.83 %
Unclassified	root	N/A	37.86 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	1.94 %
Phaseolus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus	0.97 %
Cajanus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.86 %
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	34.95 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	1.94 %
Phaseolus vulgaris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	0.97 %
Cajanus cajan	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.86 %
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	34.95 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	3.88 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1.94 %
Phaseolus vulgaris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	0.97 %
Cajanus cajan	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006943\|Ga0099822_1000858	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	32258	Open in IMG/M
3300006943\|Ga0099822_1004160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	18762	Open in IMG/M
3300006943\|Ga0099822_1004207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	18665	Open in IMG/M
3300006943\|Ga0099822_1006831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	14810	Open in IMG/M
3300006943\|Ga0099822_1008159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13413	Open in IMG/M
3300006943\|Ga0099822_1008658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	12982	Open in IMG/M
3300006943\|Ga0099822_1008798	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	12864	Open in IMG/M
3300006943\|Ga0099822_1013543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	9534	Open in IMG/M
3300006943\|Ga0099822_1014679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	8949	Open in IMG/M
3300006943\|Ga0099822_1016547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	8078	Open in IMG/M
3300006943\|Ga0099822_1017146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7803	Open in IMG/M
3300006943\|Ga0099822_1018531	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7233	Open in IMG/M
3300006943\|Ga0099822_1018924	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7097	Open in IMG/M
3300006943\|Ga0099822_1020145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6672	Open in IMG/M
3300006943\|Ga0099822_1020481	Not Available	6558	Open in IMG/M
3300006943\|Ga0099822_1020481	Not Available	6558	Open in IMG/M
3300006943\|Ga0099822_1021406	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6260	Open in IMG/M
3300006943\|Ga0099822_1022158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6035	Open in IMG/M
3300006943\|Ga0099822_1022425	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5959	Open in IMG/M
3300006943\|Ga0099822_1022941	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5820	Open in IMG/M
3300006943\|Ga0099822_1024029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5518	Open in IMG/M
3300006943\|Ga0099822_1024540	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5384	Open in IMG/M
3300006943\|Ga0099822_1024647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5354	Open in IMG/M
3300006943\|Ga0099822_1024943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5281	Open in IMG/M
3300006943\|Ga0099822_1025651	Not Available	5091	Open in IMG/M
3300006943\|Ga0099822_1026016	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan	5008	Open in IMG/M
3300006943\|Ga0099822_1028460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4469	Open in IMG/M
3300006943\|Ga0099822_1029539	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4247	Open in IMG/M
3300006943\|Ga0099822_1030608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4045	Open in IMG/M
3300006943\|Ga0099822_1033175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3591	Open in IMG/M
3300006943\|Ga0099822_1034168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	3425	Open in IMG/M
3300006943\|Ga0099822_1034556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3366	Open in IMG/M
3300006943\|Ga0099822_1036961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3019	Open in IMG/M
3300006943\|Ga0099822_1037721	Not Available	2916	Open in IMG/M
3300006943\|Ga0099822_1038401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2831	Open in IMG/M
3300006943\|Ga0099822_1038837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	2779	Open in IMG/M
3300006943\|Ga0099822_1039177	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2736	Open in IMG/M
3300006943\|Ga0099822_1042292	Not Available	2389	Open in IMG/M
3300006943\|Ga0099822_1043749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2257	Open in IMG/M
3300006943\|Ga0099822_1046543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2021	Open in IMG/M
3300006943\|Ga0099822_1047597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1943	Open in IMG/M
3300006943\|Ga0099822_1048044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1909	Open in IMG/M
3300006943\|Ga0099822_1048303	Not Available	1890	Open in IMG/M
3300006943\|Ga0099822_1049396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris	1813	Open in IMG/M
3300006943\|Ga0099822_1049790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1788	Open in IMG/M
3300006943\|Ga0099822_1050678	Not Available	1731	Open in IMG/M
3300006943\|Ga0099822_1052785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1605	Open in IMG/M
3300006943\|Ga0099822_1053318	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1577	Open in IMG/M
3300006943\|Ga0099822_1057092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1400	Open in IMG/M
3300006943\|Ga0099822_1058133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1356	Open in IMG/M
3300006943\|Ga0099822_1059370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	1306	Open in IMG/M
3300006943\|Ga0099822_1064100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1149	Open in IMG/M
3300006943\|Ga0099822_1064224	Not Available	1145	Open in IMG/M
3300006943\|Ga0099822_1064678	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1130	Open in IMG/M
3300006943\|Ga0099822_1064750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1128	Open in IMG/M
3300006943\|Ga0099822_1064973	Not Available	1122	Open in IMG/M
3300006943\|Ga0099822_1067311	Not Available	1058	Open in IMG/M
3300006943\|Ga0099822_1070530	Not Available	983	Open in IMG/M
3300006943\|Ga0099822_1072685	Not Available	936	Open in IMG/M
3300006943\|Ga0099822_1073359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	923	Open in IMG/M
3300006943\|Ga0099822_1073420	Not Available	922	Open in IMG/M
3300006943\|Ga0099822_1074279	Not Available	906	Open in IMG/M
3300006943\|Ga0099822_1074482	Not Available	903	Open in IMG/M
3300006943\|Ga0099822_1076531	Not Available	867	Open in IMG/M
3300006943\|Ga0099822_1077345	Not Available	852	Open in IMG/M
3300006943\|Ga0099822_1078076	Not Available	841	Open in IMG/M
3300006943\|Ga0099822_1079910	Not Available	812	Open in IMG/M
3300006943\|Ga0099822_1083031	Not Available	769	Open in IMG/M
3300006943\|Ga0099822_1083597	Not Available	762	Open in IMG/M
3300006943\|Ga0099822_1083696	Not Available	760	Open in IMG/M
3300006943\|Ga0099822_1084243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	753	Open in IMG/M
3300006943\|Ga0099822_1085165	Not Available	742	Open in IMG/M
3300006943\|Ga0099822_1086421	Not Available	727	Open in IMG/M
3300006943\|Ga0099822_1088662	Not Available	702	Open in IMG/M
3300006943\|Ga0099822_1094702	Not Available	643	Open in IMG/M
3300006943\|Ga0099822_1098608	Not Available	612	Open in IMG/M
3300006943\|Ga0099822_1099909	Not Available	602	Open in IMG/M
3300006943\|Ga0099822_1108409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	547	Open in IMG/M
3300006943\|Ga0099822_1108575	Not Available	546	Open in IMG/M
3300006943\|Ga0099822_1110362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	536	Open in IMG/M
3300006943\|Ga0099822_1114262	Not Available	517	Open in IMG/M
3300006944\|Ga0099823_1024320	Not Available	5485	Open in IMG/M
3300006944\|Ga0099823_1032024	Not Available	4304	Open in IMG/M
3300006944\|Ga0099823_1072933	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1483	Open in IMG/M
3300006944\|Ga0099823_1120963	Not Available	673	Open in IMG/M
3300006944\|Ga0099823_1129906	Not Available	611	Open in IMG/M
3300021320\|Ga0214544_1011374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12337	Open in IMG/M
3300021320\|Ga0214544_1014974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	8346	Open in IMG/M
3300021320\|Ga0214544_1020642	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4600	Open in IMG/M
3300021320\|Ga0214544_1026090	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	2664	Open in IMG/M
3300021320\|Ga0214544_1035010	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1372	Open in IMG/M
3300021320\|Ga0214544_1057195	Not Available	564	Open in IMG/M
3300021321\|Ga0214542_1001987	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42389	Open in IMG/M
3300021321\|Ga0214542_1010556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13384	Open in IMG/M
3300021324\|Ga0214545_1008645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	16080	Open in IMG/M
3300021324\|Ga0214545_1016931	All Organisms → cellular organisms → Eukaryota	7280	Open in IMG/M
3300021324\|Ga0214545_1028962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	2563	Open in IMG/M
3300021324\|Ga0214545_1050538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	828	Open in IMG/M
3300021327\|Ga0214543_1061464	Not Available	598	Open in IMG/M
3300021327\|Ga0214543_1062999	Not Available	576	Open in IMG/M
3300027296\|Ga0209389_1034044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	4179	Open in IMG/M
3300027296\|Ga0209389_1125185	Not Available	672	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0099822_100085812	3300006943	Root Nodules	MKEETIKMESKGDDQWKKHATHRGDLSQPNLRDE*
Ga0099822_100416028	3300006943	Root Nodules	MKEETMKMESKGDDKWKKHATHRGDLSQPNPRDE*
Ga0099822_100420735	3300006943	Root Nodules	MKEETLKMESIEDEQWVKHATYSGDLSHPNPREE*
Ga0099822_100683131	3300006943	Root Nodules	MKEETIKMESIEDEAWKKHATHRGDLSQPSPRDE*
Ga0099822_100815923	3300006943	Root Nodules	MKEETIKMESIEDEEWKKRATHRGDLSQPNPRDE*
Ga0099822_10086582	3300006943	Root Nodules	MKGETNKMESIEDGKWVKHTTHRGDLSQPNHRDE*
Ga0099822_10087981	3300006943	Root Nodules	MKEETLKMKSIEDEAWKKHATHRGDLSQPNPRDD*
Ga0099822_101354317	3300006943	Root Nodules	MKEETLKMESIEDEQWVKHATHKGDLSQPNPRDE*
Ga0099822_101467916	3300006943	Root Nodules	MKEETIKMESIEDEEWKQHTTHRGDLSQPNPRDE*
Ga0099822_101654715	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPSPRDK*
Ga0099822_101714614	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPNPRDE*WCRH
Ga0099822_101853112	3300006943	Root Nodules	MKDETIKMESIEDEEWKKHATHRGDLSQPNPRDE*
Ga0099822_10189241	3300006943	Root Nodules	MKEETLKMESIEHEAWKKHTTHRGDLSQPSPRDE*
Ga0099822_10201451	3300006943	Root Nodules	MKEETLKMKSIEDEAWKKHATHRGDLSQPNPRDE*
Ga0099822_10204811	3300006943	Root Nodules	MKEKALKMESIEDEEWKKHATHRGDLSQPNPRDEWCRHLQAR
Ga0099822_10204819	3300006943	Root Nodules	MKEETLKMENIEDEKWMKNATHRGDLSQPNPRDE*
Ga0099822_102140613	3300006943	Root Nodules	MKEETMKMESKADDKWKKHATHRGDLSQPNPRDE*
Ga0099822_10221581	3300006943	Root Nodules	MKEETLKMGSIEDQQWVKHATHKGDLSQPNPRDE*
Ga0099822_10224252	3300006943	Root Nodules	MKEEISKMESIEDEQWVKHVTHRGDLSQPNPRDE*
Ga0099822_10229411	3300006943	Root Nodules	VKEEALKIESIEDEAWEKHLTHRGDLSQPSPKDE*
Ga0099822_102402910	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATDRGDLSQPSPRDE*
Ga0099822_10245401	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATHRGDLSQPNPRDE*
Ga0099822_10246472	3300006943	Root Nodules	MKEETLKMETIKDEQWVKHAIHRGDLSQPNPRDE*
Ga0099822_10249438	3300006943	Root Nodules	MEEETLKMESIEDEVWKKHATHRWDLSQPSPRDE*
Ga0099822_10256518	3300006943	Root Nodules	MKEEALKMESLEDEAWKKHATHRGDLSQPNPTDE*
Ga0099822_102601610	3300006943	Root Nodules	MKEETIKMESIEDEQWMKNATHRGDLSQPNPKDE*
Ga0099822_102846010	3300006943	Root Nodules	MKEETLKMGSIEDEAWKKHATHRGDLSQPNPRDE*
Ga0099822_102953912	3300006943	Root Nodules	MKEETIKMEGIKDEEWKKHTTHRGDLSQPSPRDE*
Ga0099822_10306085	3300006943	Root Nodules	MKEETIKMESIKDEQWKKHATHRGDLSQPNPKDE*
Ga0099822_10331753	3300006943	Root Nodules	MKEEKLKMESIENEQWKKHATHRRDLSQPNPRDE*
Ga0099822_10341682	3300006943	Root Nodules	MKEEIMKMESKGDDKWKKRATHRADLSQPNPRDE*
Ga0099822_10345561	3300006943	Root Nodules	MKEETLKMESIEDGVWKKHATHRGDLSQPSPRDE*
Ga0099822_10369615	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPNPRDE*
Ga0099822_10377211	3300006943	Root Nodules	MKEEIIKMERIEDEEWKKHATHRGDLGQLNPRDE*
Ga0099822_10384012	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATRRGDLSQPSPRDE*
Ga0099822_10385395	3300006943	Root Nodules	MKEETMKIESKGDDKLKKTPLIGGNLSQPNPKDD*
Ga0099822_10388371	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATHRGDLSQPSPRDE*W
Ga0099822_10391777	3300006943	Root Nodules	MKEETIKMKNIEDEEWKKHATHRGDLSQPSPRDK*
Ga0099822_10422924	3300006943	Root Nodules	MKKETLKMEIIEDEAWKKHATHRGDLSQPNPRDE*
Ga0099822_10437494	3300006943	Root Nodules	MKEETIKMESIEDEQWKKHTIHRGDLSQPNPRDE*
Ga0099822_10465431	3300006943	Root Nodules	MKEETLKMESIEDEQWVKHATHRGDLSQPNPRDE*
Ga0099822_10475972	3300006943	Root Nodules	MKEETLEMESIEDEAWKKHAIHRGDLSQPSPRDE*
Ga0099822_10480442	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHMGDLSQPNPRDE*
Ga0099822_10483031	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATHRGDLSQPSLRDE*
Ga0099822_10493962	3300006943	Root Nodules	MKEETMTMESKEDDQWKKHAIHRGDLSQPNPRDE*
Ga0099822_10497901	3300006943	Root Nodules	MKEETLKMESIEDEQWVKHTTHRGDLSQPNPRDE*
Ga0099822_10506784	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATHGGDLSQPSPRDE*
Ga0099822_10527853	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPRSREE*
Ga0099822_10533181	3300006943	Root Nodules	MKEETLKMESIEDGVWKKHVTHRGDLTQPSPRDE*
Ga0099822_10570923	3300006943	Root Nodules	MKEETIKMASIEDEEWKKHATHRGDLSQPSPRDE*
Ga0099822_10581332	3300006943	Root Nodules	MKEEKLKMESIEEEQWVKHATYRGDLSQPNPRDERWCRHLQAR*
Ga0099822_10593704	3300006943	Root Nodules	MKEETLKMGSIEDEAWKKHATHRGDLSQPSPRDE*
Ga0099822_10641002	3300006943	Root Nodules	MKEETMKMESKGDDKWKKHAIHWGDLSQPNPRDE*
Ga0099822_10642241	3300006943	Root Nodules	MKEETIKMENIEDEEWKKHATHRGDLSQPSPRDE*
Ga0099822_10646781	3300006943	Root Nodules	MKEETIKMESIEDDEWKKHATHRGDLSQPSPRDE*
Ga0099822_10647502	3300006943	Root Nodules	MEEETLKMESLEDEAWKKHATHRGDLSQPSPKDE*
Ga0099822_10649731	3300006943	Root Nodules	MKEETIKIESIQDEEWKKHATHRGDLSQPNPRYE*
Ga0099822_10673112	3300006943	Root Nodules	MKEEALKIESIEDEAWEKHVTHRGDLSQPSPRDE*
Ga0099822_10705302	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHVTHRGDLSQPNPRDE*
Ga0099822_10726852	3300006943	Root Nodules	MKEEKLKTESIEDEEWKKHATHRGDLSQQNPRDE*
Ga0099822_10733592	3300006943	Root Nodules	MKEETLKMESREDEAWKKHATHRGDLSQPSPRDE*
Ga0099822_10734202	3300006943	Root Nodules	MKEETIKMESIEDEAWKKHATYRGDLSQPSPRDK*
Ga0099822_10742792	3300006943	Root Nodules	MKEETSKMESIKDEQWVKHATYRGDLSQPNPIDE*
Ga0099822_10744821	3300006943	Root Nodules	MKEETIKMESIEDEQWMKHATHRGDLSQPNPRDE*
Ga0099822_10765311	3300006943	Root Nodules	MKEETLKMESIEDEAWKKHATHRRDLSQPSPRDE*
Ga0099822_10773452	3300006943	Root Nodules	MKEETMKMENKGDDKWKKHATHRGDLSQPNPRDE*
Ga0099822_10780762	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHAVHRGDLSQPSPRDE*
Ga0099822_10799102	3300006943	Root Nodules	MKEETLKMENIEDEQWVKHATHRGGLSQPNPRDE*
Ga0099822_10830311	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPSPRDE*
Ga0099822_10835972	3300006943	Root Nodules	MKEETKKMESIEDEEWKKHATHRGDLSQPRPRDE*
Ga0099822_10836962	3300006943	Root Nodules	MKEETIKMESIKDEEWKKHATHRGDLSQPNPRDE*
Ga0099822_10842432	3300006943	Root Nodules	MKEETLKMESIEDKAWKKHATNRGDLSQPSPRDE*
Ga0099822_10851652	3300006943	Root Nodules	MKEETLEMESIEDEAWKKHVTHRGDLSQPSPRDE*
Ga0099822_10864211	3300006943	Root Nodules	MKEETLKIESIEDEQWVKHATHREDLSQPNPRDE*
Ga0099822_10886621	3300006943	Root Nodules	MKEEALKMESIEDGAWKKNATHRGDLSQPSPRDE*
Ga0099822_10947021	3300006943	Root Nodules	MKEETLKMESIEDEAWQKHATHRGDLSQPSPRDE*
Ga0099822_10986081	3300006943	Root Nodules	MKEETLKMESIDDEAWKNHATHRGDLSQPSPRDE*
Ga0099822_10999091	3300006943	Root Nodules	MKEETIKMESIEDKEWKKHATHMGDLSQPNPRDE*
Ga0099822_11084091	3300006943	Root Nodules	MKEEIIKMESIEDEEWKKHVTHRGDLSQLNPIDE*
Ga0099822_11085752	3300006943	Root Nodules	MKEETIKMDSMEDEEWKKHATHWGDLSQPSPRDE*
Ga0099822_11103621	3300006943	Root Nodules	MKEEALKMESIEDGAWKKHATHRGDLSQPSPRDE*
Ga0099822_11142622	3300006943	Root Nodules	MKEETIKMESIEDEEWKKHVTHRGDLSQPSPRDE*
Ga0099823_10243201	3300006944	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPSPRDE*W
Ga0099823_10320246	3300006944	Root Nodules	MKEKALKMESIEDEEWKKHATHRGDLSQPNPRDE*
Ga0099823_10729333	3300006944	Root Nodules	MKEQTLKMESIKDEAWKKHVTHRGDLSQPNPRDE*
Ga0099823_11209631	3300006944	Root Nodules	MKEEALKMESIEDGAWKKHTTHRGDLSQPIPRDE*
Ga0099823_11299061	3300006944	Root Nodules	LKNKMKEETLKMESIEDEQWVKHTTHRGDLSQPNPRDE*
Ga0214544_10113745	3300021320	Root Nodules	MKEEKLKMESIEEEQWVKHATYRGDLSQPNPRDERWCRHLQAR
Ga0214544_10149749	3300021320	Root Nodules	MKGRRELDSSKMKEETIKMESIEDEEWKKHATHSGDLSQQNPRDE
Ga0214544_10206423	3300021320	Root Nodules	KSKMKEETIKMESIEDEEWKKHATHRGDLSQPNPRDE
Ga0214544_10260904	3300021320	Root Nodules	TLKSKMKEETIKMESIEDEAWKKHATHRGDLSQPSPRDE
Ga0214544_10350101	3300021320	Root Nodules	EITTLKSKMKEETIKMESIEDEEWKKHATHRGDLSQPSPRDE
Ga0214544_10571951	3300021320	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPSPRDEXWC
Ga0214542_100198710	3300021321	Root Nodules	MKEETLKMESIEDEAWKKHATHRGDLSQPNPRDEXWCHHLQAR
Ga0214542_10105561	3300021321	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPNPKDESWCRHLQAR
Ga0214545_100864515	3300021324	Root Nodules	MKEETIKMESIEDEEWKKHATHRGDLSQPSPRDEXWCR
Ga0214545_10169311	3300021324	Root Nodules	MKEKALKMESIEDEEWKKHATHRGDLSQPNPRDEXWCRHLQAR
Ga0214545_10289621	3300021324	Root Nodules	MKEETLKMESIEDEAWKKHATHRGDLSQPSPRDEXWC
Ga0214545_10505382	3300021324	Root Nodules	KSKIKEETIKMESIEDEEWMKHATHRGDLSQPNPRDE
Ga0214543_10614641	3300021327	Root Nodules	MKEETIKMESIKDEEWKKHATHRGDLSQPSPIDEXWCR
Ga0214543_10629991	3300021327	Root Nodules	KMKEETIKMESIEDEEWKKHATHRGDLSQPNPRDE
Ga0209389_10340442	3300027296	Root Nodules	MKEETLKMESIEDEAWKKHATHNGRSTPLIGGDLSQPSPRDE
Ga0209389_11251851	3300027296	Root Nodules	MKEETSKMESIKDEQWVKHATYRGDLSQPNPIDEXW

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F098772

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Host-Associated	Open in IMG/M
3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Host-Associated	Open in IMG/M
3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Host-Associated	Open in IMG/M
3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Host-Associated	Open in IMG/M
3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Host-Associated	Open in IMG/M
3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Host-Associated	Open in IMG/M
3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign