NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098861

Metagenome Family F098861

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098861
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 47 residues
Representative Sequence MEVGRNAIGNVAERIKNQKPAIILETDKTFASILEIQRELGKLLGALR
Number of Associated Samples 93
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.88 %
% of genes near scaffold ends (potentially truncated) 94.17 %
% of genes from short scaffolds (< 2000 bps) 91.26 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.058 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.680 % of family members)
Environment Ontology (ENVO) Unclassified
(33.010 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(31.068 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.47%    β-sheet: 0.00%    Coil/Unstructured: 60.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00528BPD_transp_1 18.45
PF00005ABC_tran 1.94
PF01557FAA_hydrolase 0.97
PF00676E1_dh 0.97
PF08402TOBE_2 0.97
PF13751DDE_Tnp_1_6 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.97
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.06 %
UnclassifiedrootN/A1.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2056173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104937973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300000559|F14TC_101811809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300000787|JGI11643J11755_11065997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300000787|JGI11643J11755_11208859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300000858|JGI10213J12805_10341180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium708Open in IMG/M
3300000891|JGI10214J12806_10587924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300003324|soilH2_10192333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1651Open in IMG/M
3300004050|Ga0055491_10138484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300004052|Ga0055490_10007792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2192Open in IMG/M
3300004157|Ga0062590_102120739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300004268|Ga0066398_10129299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300004633|Ga0066395_10351942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300004643|Ga0062591_102507141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300004808|Ga0062381_10234387All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300005457|Ga0070662_100128129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1953Open in IMG/M
3300005458|Ga0070681_10052424All Organisms → cellular organisms → Bacteria → Proteobacteria4068Open in IMG/M
3300005471|Ga0070698_100811685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300005518|Ga0070699_101089159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300005540|Ga0066697_10659757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300005546|Ga0070696_101683165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300005577|Ga0068857_100365327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1338Open in IMG/M
3300005618|Ga0068864_101802095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300005713|Ga0066905_101580791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium599Open in IMG/M
3300005843|Ga0068860_100179763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2045Open in IMG/M
3300006049|Ga0075417_10293611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium787Open in IMG/M
3300006844|Ga0075428_101022707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium874Open in IMG/M
3300006844|Ga0075428_102221303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300006854|Ga0075425_102581726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300006881|Ga0068865_101415662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300009053|Ga0105095_10588157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300009053|Ga0105095_10674178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300009078|Ga0105106_11080120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300009094|Ga0111539_10143384All Organisms → cellular organisms → Bacteria → Proteobacteria2796Open in IMG/M
3300009153|Ga0105094_10246782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1025Open in IMG/M
3300009162|Ga0075423_10899392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium938Open in IMG/M
3300009162|Ga0075423_11237408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium797Open in IMG/M
3300009162|Ga0075423_12191036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300009174|Ga0105241_10396550All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1209Open in IMG/M
3300010043|Ga0126380_10233086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1260Open in IMG/M
3300010358|Ga0126370_12625739Not Available504Open in IMG/M
3300010362|Ga0126377_13474774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300010376|Ga0126381_104018196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300010376|Ga0126381_104910409Not Available513Open in IMG/M
3300010399|Ga0134127_12243053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300010400|Ga0134122_11583027All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300010403|Ga0134123_11151505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300011427|Ga0137448_1150976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300011427|Ga0137448_1239555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300012038|Ga0137431_1019105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1871Open in IMG/M
3300012040|Ga0137461_1264899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300012171|Ga0137342_1019698All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1220Open in IMG/M
3300012202|Ga0137363_10868675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300012210|Ga0137378_11780596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300012225|Ga0137434_1041603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300012915|Ga0157302_10552740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300012984|Ga0164309_11902033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300013104|Ga0157370_11976451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300014271|Ga0075326_1107878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300014866|Ga0180090_1051220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300014872|Ga0180087_1106718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300014877|Ga0180074_1136091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300014882|Ga0180069_1067526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium822Open in IMG/M
3300015245|Ga0137409_11288213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300015371|Ga0132258_11487094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1711Open in IMG/M
3300015372|Ga0132256_101269751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium849Open in IMG/M
3300016371|Ga0182034_10860414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300016371|Ga0182034_10871206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300016445|Ga0182038_10812120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300018052|Ga0184638_1181101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium748Open in IMG/M
3300018052|Ga0184638_1332258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300018053|Ga0184626_10358249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300018064|Ga0187773_10106522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1390Open in IMG/M
3300018071|Ga0184618_10040864All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1645Open in IMG/M
3300018422|Ga0190265_12957183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300018469|Ga0190270_12937206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300018476|Ga0190274_11011692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium906Open in IMG/M
3300018482|Ga0066669_11131040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300021073|Ga0210378_10093937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1170Open in IMG/M
3300022694|Ga0222623_10078855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1277Open in IMG/M
3300025146|Ga0209322_10038128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2350Open in IMG/M
3300025159|Ga0209619_10069153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2169Open in IMG/M
3300025931|Ga0207644_11245099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300025936|Ga0207670_11642737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300027490|Ga0209899_1094049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300027654|Ga0209799_1000667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium6378Open in IMG/M
3300027691|Ga0209485_1052294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1052Open in IMG/M
3300027815|Ga0209726_10117454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1560Open in IMG/M
3300027873|Ga0209814_10411176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300027907|Ga0207428_10130444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1924Open in IMG/M
3300027909|Ga0209382_10597388All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1202Open in IMG/M
3300028809|Ga0247824_10869711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300031720|Ga0307469_10819327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium855Open in IMG/M
3300031740|Ga0307468_100022028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. OK0852838Open in IMG/M
3300031854|Ga0310904_10371518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300031858|Ga0310892_10397034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium897Open in IMG/M
3300031942|Ga0310916_11565750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300031965|Ga0326597_10101952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3495Open in IMG/M
3300032004|Ga0307414_10399770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1193Open in IMG/M
3300033513|Ga0316628_102949583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300033513|Ga0316628_103475031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300034149|Ga0364929_0119715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium840Open in IMG/M
3300034164|Ga0364940_0226392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.97%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.97%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_205617323300000033SoilEVRYETSGQANEVGRNAIGAVAERIKAGRPAIILETEKNFTAILEIQRELGKLLGALR*
INPhiseqgaiiFebDRAFT_10493797313300000364SoilATRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR*
F14TC_10181180913300000559SoilMEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR*
JGI11643J11755_1106599723300000787SoilEVGRNAIGAVAERIKAGRPAIILETEKNFTAILEIQRELGKLLGALR*
JGI11643J11755_1120885923300000787SoilNVADRIRSEKPSVILETEKTFAGILEIQREMGKLLGALR*
JGI10213J12805_1034118013300000858SoilAMEVGKNAIGNVAERIRNEKPPVILETDKTFTSILEIQREMGKLLGALR*
JGI10214J12806_1058792413300000891SoilVGKSAIGSVADRIRAQQPAIILETDKTFANILEIQRELGKMLGALR*
soilH2_1019233323300003324Sugarcane Root And Bulk SoilNAIGNVAERIKSQQPSIILETDKTFASILEIQRELGKLLGALR*
Ga0055491_1013848423300004050Natural And Restored WetlandsMEVGRNAIGNVAERIRSQKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0055490_1000779223300004052Natural And Restored WetlandsIRYSIRGQSMEVGRNAIGNVAERIRSQKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0062590_10212073913300004157SoilRIRYNTSGQSMEVGRNAIGNVAERIKSQQPSIILETDKTFASILEIQRELGKLLGALR*
Ga0066398_1012929923300004268Tropical Forest SoilIEVGKNAIGNVADRLKASRPTIILETEKNFAAILEIQRELGKLLGALR*
Ga0066395_1035194223300004633Tropical Forest SoilAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR*
Ga0062591_10250714113300004643SoilQSMEVGRNAIGNVADRIRSEKPSVILETEKTFAGILEIQREMGKLLGALR*
Ga0062381_1023438723300004808Wetland SedimentMEVGKNAIGNVAERLRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0070662_10012812913300005457Corn RhizosphereIGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0070681_1005242443300005458Corn RhizosphereQNIRYATQGQAMEVGRNAIGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0070698_10081168513300005471Corn, Switchgrass And Miscanthus RhizosphereRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKMLGALR*
Ga0070699_10108915913300005518Corn, Switchgrass And Miscanthus RhizosphereRNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR*
Ga0066697_1065975723300005540SoilKIRYATRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR*
Ga0070696_10168316513300005546Corn, Switchgrass And Miscanthus RhizosphereNEVGRNSIGAVADRIKAAHPAVILETDKNFTAILEIQRELGKLLGALR*
Ga0068857_10036532723300005577Corn RhizosphereERIRSEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0068864_10180209513300005618Switchgrass RhizosphereAQKIRYSIRGQSMEVGRNAIGNVAERIRSEKPAVILETEKTFAGILEIQREMGKLLGALR
Ga0066905_10158079123300005713Tropical Forest SoilANEVGKNAIGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR*
Ga0068860_10017976313300005843Switchgrass RhizosphereNAIGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0075417_1029361113300006049Populus RhizosphereARGQAMEVGRNAIGNVAERIRSQKPAIILETDKTFTSILEIQRELGKLLGALR*
Ga0075428_10102270713300006844Populus RhizosphereAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR*
Ga0075428_10222130313300006844Populus RhizosphereGSVAERIRSQKPAIILETDKTFASILEIQRELGKLLGALR*
Ga0075425_10258172613300006854Populus RhizosphereQGQAMEVGRNAIGNVAERIKSQQPTVILETDKTFASILEIQRELGKLLGALR*
Ga0068865_10141566223300006881Miscanthus RhizosphereMEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0105095_1058815713300009053Freshwater SedimentNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0105095_1067417823300009053Freshwater SedimentERIRSGKPAIILETEKNFGPILEIQRELGKMLGALR*
Ga0105106_1108012013300009078Freshwater SedimentKIRYSIRGQSMEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0111539_1014338413300009094Populus RhizosphereGQAMEVGRNAIGNVAERIKSQKPAIILETDKTFTSILEIQRELGKLLGALR*
Ga0105094_1024678213300009153Freshwater SedimentMEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0075423_1089939213300009162Populus RhizosphereIRYGTRGQAMEVGRNAIGNVAERIKSQQPAIILETDKTFASILEIQRELGKLLGALR*
Ga0075423_1123740813300009162Populus RhizosphereNEVGRNAIGVVAERIKAARPAIILETEKNFTAILEIQRELGKLLGALR*
Ga0075423_1219103623300009162Populus RhizosphereNAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR*
Ga0105241_1039655013300009174Corn RhizosphereQAMEVGRNAIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0126380_1023308623300010043Tropical Forest SoilASGQANEVGKNAIGVVAERIKAARPAVILETDKNFAGILEIQRELGKLLGALR*
Ga0126370_1262573913300010358Tropical Forest SoilANEVGKNAIGLVAEKIKATHPAIILETEKNFAAILEVQRELGKLLGALR*
Ga0126377_1347477413300010362Tropical Forest SoilQANEVGKNAIGAVAERIKAARPAVILETDKNFAPILEIQRELGKLLGALR*
Ga0126381_10401819623300010376Tropical Forest SoilKNAIGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR*
Ga0126381_10491040913300010376Tropical Forest SoilAIEVGKNAIGNVADRLKASRPTIILETEKNFAAIFEIQRELGRLLGALR*
Ga0134127_1224305323300010399Terrestrial SoilQAMEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR*
Ga0134122_1158302723300010400Terrestrial SoilQGQAMEVGRNAIGNVAERIRSEKPSVILETDKTFTSILEIQRELGKLLGALR*
Ga0134123_1115150523300010403Terrestrial SoilVDRAIGSVADRIRAQQPAIILETDKTFANILEIQRELGKMLGALR*
Ga0137448_115097623300011427SoilEVGRNAIGIVAERIKANQPAIILETEKTFATILEIQRELGKMLGALR*
Ga0137448_123955523300011427SoilYSIRGQSMEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0137431_101910523300012038SoilVAERIKANQPAIILETEKTFATILEIQRELGKMLGALR*
Ga0137461_126489913300012040SoilQKIRYSIRGQSMEVGKNAIGNVAERLRSEKPAIILETEKTFAGILEIQREMGKLLGALR*
Ga0137342_101969813300012171SoilTSGQAIEVGKNAIGAVAERIKTHQPAIILETEKTFATILEIQRELGKLLGALR*
Ga0137363_1086867523300012202Vadose Zone SoilVAERIKAAHPAIILETEKNFTAILEIQRELGKLLGALR*
Ga0137378_1178059613300012210Vadose Zone SoilTRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR*
Ga0137434_104160323300012225SoilSVAARIKTIQPAIILETENNFAGILEIQRELGKLLGALR*
Ga0157302_1055274023300012915SoilAERIRSEKPSVILETDKTFASILEIQRELGRLLGALR*
Ga0164309_1190203323300012984SoilIKSQQPAVILETDKTFASILEIQRELGKLLGALR*
Ga0157370_1197645123300013104Corn RhizosphereVAERIRSEKPSVILETDKTFASILEIQRELGRLLGALR*
Ga0075326_110787813300014271Natural And Restored WetlandsNGIGTVAERIRSGKPVIILETEKNFGPILEIQRELGKMLGALR*
Ga0180090_105122013300014866SoilIRYAIRGQSMEVGRNAIGNVAERISSEKPAVILETEKTFAGILEIQREMGKLLGALR*
Ga0180087_110671813300014872SoilAIEVGKNSIGAVAERIKASKPAIILETEKNFASILEIQRELGKMLGALR*
Ga0180074_113609113300014877SoilTTGQANEVGRTAIGAVAERIKAAQPVVILETDKTFATILEIQRELGKMLGALR*
Ga0180069_106752623300014882SoilAVAERIKTTQPAIILETEKTFATILEIQRELGKLLGALR*
Ga0137409_1128821313300015245Vadose Zone SoilAIGNVAERIKSQQPTIILETDKTFASILEIQRELGKLLGALR*
Ga0132258_1148709423300015371Arabidopsis RhizosphereRYEASGQANEVGRNAIGSVAERIKAARPAIILETDKNFTPILEIQRELGKLLGALR*
Ga0132256_10126975123300015372Arabidopsis RhizosphereTQGQAMEVGRNAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR*
Ga0182034_1086041413300016371SoilKVRYDASGQANEVGRNAIGAVAEKIKAAHPAIILETEKNFTAILEIQRELGKLLGALR
Ga0182034_1087120613300016371SoilAIGNVAERIKSEKPSIILETDKTFASILEIQRELGKMLGALR
Ga0182038_1081212023300016445SoilVAEKIKAAHPTIILETEKNFTAILEIQRELGKLLGALR
Ga0184638_118110113300018052Groundwater SedimentNAIGAVAERIKAAHPAIILETEKNFTAILEIQRELGKLLGALR
Ga0184638_133225823300018052Groundwater SedimentVAERIKAARPAVILETDKNFTAILEIQRELGKLLGALR
Ga0184626_1035824913300018053Groundwater SedimentGQANEVGRNAIGAVAERIKAARPAVILETDKNFTTILEIQRELGKLLGALR
Ga0187773_1010652223300018064Tropical PeatlandVVAERIKANQPSIILETEKTFATILEIQRELGKMLGALR
Ga0184618_1004086413300018071Groundwater SedimentMEVGRNAIGTVAERIKSNKPAIILETDKNFAAILEIQRELGKLLGALR
Ga0190265_1295718323300018422SoilAIGNVAERLRSQKPSIILETDKTFTSILEIQRELGKLLGALR
Ga0190270_1293720613300018469SoilNVAERIRSQKPAIILETDKTFTSILEIQRELGKLLGALR
Ga0190274_1101169213300018476SoilIEVGRNAIGSVAERLRSEKPSVILETEKTFAGILEIQREMGKLLGALR
Ga0066669_1113104013300018482Grasslands SoilQAMEVGRNAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR
Ga0210378_1009393713300021073Groundwater SedimentVGKNAIGAVAERIKTNKPAIILETEKNFATILEIQRELGKMLGALR
Ga0222623_1007885513300022694Groundwater SedimentVAERIKSNKPVIILETDKNFAAILEIQRELGKLLGALR
Ga0209322_1003812813300025146SoilTTGQANEVGKTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR
Ga0209619_1006915313300025159SoilEVGKTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR
Ga0207644_1124509913300025931Switchgrass RhizosphereIRYATQGQAMEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR
Ga0207670_1164273723300025936Switchgrass RhizosphereMEVGRNAIGNVAERIRTQKPAIILETDKTFASILENQRELGKLLGALR
Ga0209899_109404913300027490Groundwater SandQAIEVGKNAIGTVAERIKTSKPAIILETEKNFASILEIQRELGKMLGALR
Ga0209799_100066713300027654Tropical Forest SoilIGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR
Ga0209485_105229423300027691Agricultural SoilKNAIGNVAARIKMTQPAIILETEKNFAAILEIQRELGKQLGALR
Ga0209726_1011745423300027815GroundwaterRNAIGLVAERIKANQPAIILETDKTFATILEIQRELGKMLGALR
Ga0209814_1041117623300027873Populus RhizosphereAMEVGRNAIGNVSERIRRQKPAIILETDKTFTSILEIQRELGKLLGALR
Ga0207428_1013044413300027907Populus RhizosphereNAIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR
Ga0209382_1059738823300027909Populus RhizosphereIGNVAERIRSQKPAIILETDKTFASILEIQRELGKLLGALR
Ga0247824_1086971113300028809SoilVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR
Ga0307469_1081932713300031720Hardwood Forest SoilGRNAIGNVADRLKATRPTIILETEKNFAAILEIQRELGKLLGALR
Ga0307468_10002202813300031740Hardwood Forest SoilSGQAIEVGRNAIGNVADRLKATRPTIILETEKNFAAILEIQRELGKLLGALR
Ga0310904_1037151813300031854SoilGRNAIGNVAERIRSEKPAIILETDKTFASILEIQRELGKLLGALR
Ga0310892_1039703423300031858SoilEVGRNAIGSVAERIKAARPAIILETDKNFTPILEIQRELGKLLGALR
Ga0310916_1156575013300031942SoilAERIKSEKPSIILETDKTFASILEIQRELGKMLGALR
Ga0326597_1010195213300031965SoilTGQANEVGRTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR
Ga0307414_1039977023300032004RhizosphereMEVGKTAIGNVAERIRNEKPPIILETDKTFTAILEIQREMGKLLGALR
Ga0316628_10294958323300033513SoilMEVGRNAIGNVAERIKNQKPAIILETDKTFASILEIQRELGKLLGALR
Ga0316628_10347503133300033513SoilKVRYETSGQANEVGKNAIGAVAERIRTARPAIILETDKNFTAILEIQRELGKLLGALR
Ga0364929_0119715_99_2453300034149SedimentMEVGRNAIGNVAERIRTQKPAIILETDKTFASILEIQRELGKLLGALR
Ga0364940_0226392_48_1943300034164SedimentMEVGKNAIGAVAERIKAAQPAIILETDKTFATILEIQRELGKMLGALR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.