Basic Information | |
---|---|
Family ID | F098861 |
Family Type | Metagenome |
Number of Sequences | 103 |
Average Sequence Length | 47 residues |
Representative Sequence | MEVGRNAIGNVAERIKNQKPAIILETDKTFASILEIQRELGKLLGALR |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.88 % |
% of genes near scaffold ends (potentially truncated) | 94.17 % |
% of genes from short scaffolds (< 2000 bps) | 91.26 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.058 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.680 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.010 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.068 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.47% β-sheet: 0.00% Coil/Unstructured: 60.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 18.45 |
PF00005 | ABC_tran | 1.94 |
PF01557 | FAA_hydrolase | 0.97 |
PF00676 | E1_dh | 0.97 |
PF08402 | TOBE_2 | 0.97 |
PF13751 | DDE_Tnp_1_6 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.97 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.06 % |
Unclassified | root | N/A | 1.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c2056173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104937973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
3300000559|F14TC_101811809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
3300000787|JGI11643J11755_11065997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
3300000787|JGI11643J11755_11208859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
3300000858|JGI10213J12805_10341180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 708 | Open in IMG/M |
3300000891|JGI10214J12806_10587924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
3300003324|soilH2_10192333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1651 | Open in IMG/M |
3300004050|Ga0055491_10138484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300004052|Ga0055490_10007792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2192 | Open in IMG/M |
3300004157|Ga0062590_102120739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
3300004268|Ga0066398_10129299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300004633|Ga0066395_10351942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 819 | Open in IMG/M |
3300004643|Ga0062591_102507141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300004808|Ga0062381_10234387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300005457|Ga0070662_100128129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1953 | Open in IMG/M |
3300005458|Ga0070681_10052424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4068 | Open in IMG/M |
3300005471|Ga0070698_100811685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 880 | Open in IMG/M |
3300005518|Ga0070699_101089159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
3300005540|Ga0066697_10659757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
3300005546|Ga0070696_101683165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300005577|Ga0068857_100365327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1338 | Open in IMG/M |
3300005618|Ga0068864_101802095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300005713|Ga0066905_101580791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
3300005843|Ga0068860_100179763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2045 | Open in IMG/M |
3300006049|Ga0075417_10293611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
3300006844|Ga0075428_101022707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 874 | Open in IMG/M |
3300006844|Ga0075428_102221303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300006854|Ga0075425_102581726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300006881|Ga0068865_101415662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300009053|Ga0105095_10588157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
3300009053|Ga0105095_10674178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300009078|Ga0105106_11080120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300009094|Ga0111539_10143384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2796 | Open in IMG/M |
3300009153|Ga0105094_10246782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1025 | Open in IMG/M |
3300009162|Ga0075423_10899392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
3300009162|Ga0075423_11237408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
3300009162|Ga0075423_12191036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
3300009174|Ga0105241_10396550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1209 | Open in IMG/M |
3300010043|Ga0126380_10233086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1260 | Open in IMG/M |
3300010358|Ga0126370_12625739 | Not Available | 504 | Open in IMG/M |
3300010362|Ga0126377_13474774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
3300010376|Ga0126381_104018196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
3300010376|Ga0126381_104910409 | Not Available | 513 | Open in IMG/M |
3300010399|Ga0134127_12243053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300010400|Ga0134122_11583027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
3300010403|Ga0134123_11151505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300011427|Ga0137448_1150976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
3300011427|Ga0137448_1239555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300012038|Ga0137431_1019105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1871 | Open in IMG/M |
3300012040|Ga0137461_1264899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300012171|Ga0137342_1019698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1220 | Open in IMG/M |
3300012202|Ga0137363_10868675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
3300012210|Ga0137378_11780596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300012225|Ga0137434_1041603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
3300012915|Ga0157302_10552740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
3300012984|Ga0164309_11902033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300013104|Ga0157370_11976451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300014271|Ga0075326_1107878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
3300014866|Ga0180090_1051220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
3300014872|Ga0180087_1106718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300014877|Ga0180074_1136091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300014882|Ga0180069_1067526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 822 | Open in IMG/M |
3300015245|Ga0137409_11288213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
3300015371|Ga0132258_11487094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1711 | Open in IMG/M |
3300015372|Ga0132256_101269751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 849 | Open in IMG/M |
3300016371|Ga0182034_10860414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300016371|Ga0182034_10871206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
3300016445|Ga0182038_10812120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
3300018052|Ga0184638_1181101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300018052|Ga0184638_1332258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300018053|Ga0184626_10358249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
3300018064|Ga0187773_10106522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1390 | Open in IMG/M |
3300018071|Ga0184618_10040864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1645 | Open in IMG/M |
3300018422|Ga0190265_12957183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
3300018469|Ga0190270_12937206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
3300018476|Ga0190274_11011692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 906 | Open in IMG/M |
3300018482|Ga0066669_11131040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
3300021073|Ga0210378_10093937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1170 | Open in IMG/M |
3300022694|Ga0222623_10078855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1277 | Open in IMG/M |
3300025146|Ga0209322_10038128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2350 | Open in IMG/M |
3300025159|Ga0209619_10069153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2169 | Open in IMG/M |
3300025931|Ga0207644_11245099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300025936|Ga0207670_11642737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300027490|Ga0209899_1094049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300027654|Ga0209799_1000667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6378 | Open in IMG/M |
3300027691|Ga0209485_1052294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1052 | Open in IMG/M |
3300027815|Ga0209726_10117454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1560 | Open in IMG/M |
3300027873|Ga0209814_10411176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
3300027907|Ga0207428_10130444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1924 | Open in IMG/M |
3300027909|Ga0209382_10597388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1202 | Open in IMG/M |
3300028809|Ga0247824_10869711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300031720|Ga0307469_10819327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
3300031740|Ga0307468_100022028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. OK085 | 2838 | Open in IMG/M |
3300031854|Ga0310904_10371518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 928 | Open in IMG/M |
3300031858|Ga0310892_10397034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 897 | Open in IMG/M |
3300031942|Ga0310916_11565750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300031965|Ga0326597_10101952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3495 | Open in IMG/M |
3300032004|Ga0307414_10399770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1193 | Open in IMG/M |
3300033513|Ga0316628_102949583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
3300033513|Ga0316628_103475031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300034149|Ga0364929_0119715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 840 | Open in IMG/M |
3300034164|Ga0364940_0226392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.68% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.88% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.97% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.97% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_20561732 | 3300000033 | Soil | EVRYETSGQANEVGRNAIGAVAERIKAGRPAIILETEKNFTAILEIQRELGKLLGALR* |
INPhiseqgaiiFebDRAFT_1049379731 | 3300000364 | Soil | ATRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR* |
F14TC_1018118091 | 3300000559 | Soil | MEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR* |
JGI11643J11755_110659972 | 3300000787 | Soil | EVGRNAIGAVAERIKAGRPAIILETEKNFTAILEIQRELGKLLGALR* |
JGI11643J11755_112088592 | 3300000787 | Soil | NVADRIRSEKPSVILETEKTFAGILEIQREMGKLLGALR* |
JGI10213J12805_103411801 | 3300000858 | Soil | AMEVGKNAIGNVAERIRNEKPPVILETDKTFTSILEIQREMGKLLGALR* |
JGI10214J12806_105879241 | 3300000891 | Soil | VGKSAIGSVADRIRAQQPAIILETDKTFANILEIQRELGKMLGALR* |
soilH2_101923332 | 3300003324 | Sugarcane Root And Bulk Soil | NAIGNVAERIKSQQPSIILETDKTFASILEIQRELGKLLGALR* |
Ga0055491_101384842 | 3300004050 | Natural And Restored Wetlands | MEVGRNAIGNVAERIRSQKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0055490_100077922 | 3300004052 | Natural And Restored Wetlands | IRYSIRGQSMEVGRNAIGNVAERIRSQKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0062590_1021207391 | 3300004157 | Soil | RIRYNTSGQSMEVGRNAIGNVAERIKSQQPSIILETDKTFASILEIQRELGKLLGALR* |
Ga0066398_101292992 | 3300004268 | Tropical Forest Soil | IEVGKNAIGNVADRLKASRPTIILETEKNFAAILEIQRELGKLLGALR* |
Ga0066395_103519422 | 3300004633 | Tropical Forest Soil | AVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR* |
Ga0062591_1025071411 | 3300004643 | Soil | QSMEVGRNAIGNVADRIRSEKPSVILETEKTFAGILEIQREMGKLLGALR* |
Ga0062381_102343872 | 3300004808 | Wetland Sediment | MEVGKNAIGNVAERLRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0070662_1001281291 | 3300005457 | Corn Rhizosphere | IGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0070681_100524244 | 3300005458 | Corn Rhizosphere | QNIRYATQGQAMEVGRNAIGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0070698_1008116851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKMLGALR* |
Ga0070699_1010891591 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RNAIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR* |
Ga0066697_106597572 | 3300005540 | Soil | KIRYATRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR* |
Ga0070696_1016831651 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NEVGRNSIGAVADRIKAAHPAVILETDKNFTAILEIQRELGKLLGALR* |
Ga0068857_1003653272 | 3300005577 | Corn Rhizosphere | ERIRSEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0068864_1018020951 | 3300005618 | Switchgrass Rhizosphere | AQKIRYSIRGQSMEVGRNAIGNVAERIRSEKPAVILETEKTFAGILEIQREMGKLLGALR |
Ga0066905_1015807912 | 3300005713 | Tropical Forest Soil | ANEVGKNAIGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR* |
Ga0068860_1001797631 | 3300005843 | Switchgrass Rhizosphere | NAIGNVAERIRTEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0075417_102936111 | 3300006049 | Populus Rhizosphere | ARGQAMEVGRNAIGNVAERIRSQKPAIILETDKTFTSILEIQRELGKLLGALR* |
Ga0075428_1010227071 | 3300006844 | Populus Rhizosphere | AIGSVAERIKTNKPAIILETDKTFATILEIQRELGKLLGALR* |
Ga0075428_1022213031 | 3300006844 | Populus Rhizosphere | GSVAERIRSQKPAIILETDKTFASILEIQRELGKLLGALR* |
Ga0075425_1025817261 | 3300006854 | Populus Rhizosphere | QGQAMEVGRNAIGNVAERIKSQQPTVILETDKTFASILEIQRELGKLLGALR* |
Ga0068865_1014156622 | 3300006881 | Miscanthus Rhizosphere | MEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0105095_105881571 | 3300009053 | Freshwater Sediment | NAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0105095_106741782 | 3300009053 | Freshwater Sediment | ERIRSGKPAIILETEKNFGPILEIQRELGKMLGALR* |
Ga0105106_110801201 | 3300009078 | Freshwater Sediment | KIRYSIRGQSMEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0111539_101433841 | 3300009094 | Populus Rhizosphere | GQAMEVGRNAIGNVAERIKSQKPAIILETDKTFTSILEIQRELGKLLGALR* |
Ga0105094_102467821 | 3300009153 | Freshwater Sediment | MEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0075423_108993921 | 3300009162 | Populus Rhizosphere | IRYGTRGQAMEVGRNAIGNVAERIKSQQPAIILETDKTFASILEIQRELGKLLGALR* |
Ga0075423_112374081 | 3300009162 | Populus Rhizosphere | NEVGRNAIGVVAERIKAARPAIILETEKNFTAILEIQRELGKLLGALR* |
Ga0075423_121910362 | 3300009162 | Populus Rhizosphere | NAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR* |
Ga0105241_103965501 | 3300009174 | Corn Rhizosphere | QAMEVGRNAIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0126380_102330862 | 3300010043 | Tropical Forest Soil | ASGQANEVGKNAIGVVAERIKAARPAVILETDKNFAGILEIQRELGKLLGALR* |
Ga0126370_126257391 | 3300010358 | Tropical Forest Soil | ANEVGKNAIGLVAEKIKATHPAIILETEKNFAAILEVQRELGKLLGALR* |
Ga0126377_134747741 | 3300010362 | Tropical Forest Soil | QANEVGKNAIGAVAERIKAARPAVILETDKNFAPILEIQRELGKLLGALR* |
Ga0126381_1040181962 | 3300010376 | Tropical Forest Soil | KNAIGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR* |
Ga0126381_1049104091 | 3300010376 | Tropical Forest Soil | AIEVGKNAIGNVADRLKASRPTIILETEKNFAAIFEIQRELGRLLGALR* |
Ga0134127_122430532 | 3300010399 | Terrestrial Soil | QAMEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR* |
Ga0134122_115830272 | 3300010400 | Terrestrial Soil | QGQAMEVGRNAIGNVAERIRSEKPSVILETDKTFTSILEIQRELGKLLGALR* |
Ga0134123_111515052 | 3300010403 | Terrestrial Soil | VDRAIGSVADRIRAQQPAIILETDKTFANILEIQRELGKMLGALR* |
Ga0137448_11509762 | 3300011427 | Soil | EVGRNAIGIVAERIKANQPAIILETEKTFATILEIQRELGKMLGALR* |
Ga0137448_12395552 | 3300011427 | Soil | YSIRGQSMEVGKNAIGNVAERIRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0137431_10191052 | 3300012038 | Soil | VAERIKANQPAIILETEKTFATILEIQRELGKMLGALR* |
Ga0137461_12648991 | 3300012040 | Soil | QKIRYSIRGQSMEVGKNAIGNVAERLRSEKPAIILETEKTFAGILEIQREMGKLLGALR* |
Ga0137342_10196981 | 3300012171 | Soil | TSGQAIEVGKNAIGAVAERIKTHQPAIILETEKTFATILEIQRELGKLLGALR* |
Ga0137363_108686752 | 3300012202 | Vadose Zone Soil | VAERIKAAHPAIILETEKNFTAILEIQRELGKLLGALR* |
Ga0137378_117805961 | 3300012210 | Vadose Zone Soil | TRGQAMEVGRNAIGSVAERIKTNKPAIILETDKTFASILEIQRELGKLLGALR* |
Ga0137434_10416032 | 3300012225 | Soil | SVAARIKTIQPAIILETENNFAGILEIQRELGKLLGALR* |
Ga0157302_105527402 | 3300012915 | Soil | AERIRSEKPSVILETDKTFASILEIQRELGRLLGALR* |
Ga0164309_119020332 | 3300012984 | Soil | IKSQQPAVILETDKTFASILEIQRELGKLLGALR* |
Ga0157370_119764512 | 3300013104 | Corn Rhizosphere | VAERIRSEKPSVILETDKTFASILEIQRELGRLLGALR* |
Ga0075326_11078781 | 3300014271 | Natural And Restored Wetlands | NGIGTVAERIRSGKPVIILETEKNFGPILEIQRELGKMLGALR* |
Ga0180090_10512201 | 3300014866 | Soil | IRYAIRGQSMEVGRNAIGNVAERISSEKPAVILETEKTFAGILEIQREMGKLLGALR* |
Ga0180087_11067181 | 3300014872 | Soil | AIEVGKNSIGAVAERIKASKPAIILETEKNFASILEIQRELGKMLGALR* |
Ga0180074_11360911 | 3300014877 | Soil | TTGQANEVGRTAIGAVAERIKAAQPVVILETDKTFATILEIQRELGKMLGALR* |
Ga0180069_10675262 | 3300014882 | Soil | AVAERIKTTQPAIILETEKTFATILEIQRELGKLLGALR* |
Ga0137409_112882131 | 3300015245 | Vadose Zone Soil | AIGNVAERIKSQQPTIILETDKTFASILEIQRELGKLLGALR* |
Ga0132258_114870942 | 3300015371 | Arabidopsis Rhizosphere | RYEASGQANEVGRNAIGSVAERIKAARPAIILETDKNFTPILEIQRELGKLLGALR* |
Ga0132256_1012697512 | 3300015372 | Arabidopsis Rhizosphere | TQGQAMEVGRNAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR* |
Ga0182034_108604141 | 3300016371 | Soil | KVRYDASGQANEVGRNAIGAVAEKIKAAHPAIILETEKNFTAILEIQRELGKLLGALR |
Ga0182034_108712061 | 3300016371 | Soil | AIGNVAERIKSEKPSIILETDKTFASILEIQRELGKMLGALR |
Ga0182038_108121202 | 3300016445 | Soil | VAEKIKAAHPTIILETEKNFTAILEIQRELGKLLGALR |
Ga0184638_11811011 | 3300018052 | Groundwater Sediment | NAIGAVAERIKAAHPAIILETEKNFTAILEIQRELGKLLGALR |
Ga0184638_13322582 | 3300018052 | Groundwater Sediment | VAERIKAARPAVILETDKNFTAILEIQRELGKLLGALR |
Ga0184626_103582491 | 3300018053 | Groundwater Sediment | GQANEVGRNAIGAVAERIKAARPAVILETDKNFTTILEIQRELGKLLGALR |
Ga0187773_101065222 | 3300018064 | Tropical Peatland | VVAERIKANQPSIILETEKTFATILEIQRELGKMLGALR |
Ga0184618_100408641 | 3300018071 | Groundwater Sediment | MEVGRNAIGTVAERIKSNKPAIILETDKNFAAILEIQRELGKLLGALR |
Ga0190265_129571832 | 3300018422 | Soil | AIGNVAERLRSQKPSIILETDKTFTSILEIQRELGKLLGALR |
Ga0190270_129372061 | 3300018469 | Soil | NVAERIRSQKPAIILETDKTFTSILEIQRELGKLLGALR |
Ga0190274_110116921 | 3300018476 | Soil | IEVGRNAIGSVAERLRSEKPSVILETEKTFAGILEIQREMGKLLGALR |
Ga0066669_111310401 | 3300018482 | Grasslands Soil | QAMEVGRNAIGNVAERIKSQQPAVILETDKTFASILEIQRELGKLLGALR |
Ga0210378_100939371 | 3300021073 | Groundwater Sediment | VGKNAIGAVAERIKTNKPAIILETEKNFATILEIQRELGKMLGALR |
Ga0222623_100788551 | 3300022694 | Groundwater Sediment | VAERIKSNKPVIILETDKNFAAILEIQRELGKLLGALR |
Ga0209322_100381281 | 3300025146 | Soil | TTGQANEVGKTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR |
Ga0209619_100691531 | 3300025159 | Soil | EVGKTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR |
Ga0207644_112450991 | 3300025931 | Switchgrass Rhizosphere | IRYATQGQAMEVGKNSIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR |
Ga0207670_116427372 | 3300025936 | Switchgrass Rhizosphere | MEVGRNAIGNVAERIRTQKPAIILETDKTFASILENQRELGKLLGALR |
Ga0209899_10940491 | 3300027490 | Groundwater Sand | QAIEVGKNAIGTVAERIKTSKPAIILETEKNFASILEIQRELGKMLGALR |
Ga0209799_10006671 | 3300027654 | Tropical Forest Soil | IGAVAERIKAARPAVILETDKNFAAILEIQRELGKLLGALR |
Ga0209485_10522942 | 3300027691 | Agricultural Soil | KNAIGNVAARIKMTQPAIILETEKNFAAILEIQRELGKQLGALR |
Ga0209726_101174542 | 3300027815 | Groundwater | RNAIGLVAERIKANQPAIILETDKTFATILEIQRELGKMLGALR |
Ga0209814_104111762 | 3300027873 | Populus Rhizosphere | AMEVGRNAIGNVSERIRRQKPAIILETDKTFTSILEIQRELGKLLGALR |
Ga0207428_101304441 | 3300027907 | Populus Rhizosphere | NAIGNVAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR |
Ga0209382_105973882 | 3300027909 | Populus Rhizosphere | IGNVAERIRSQKPAIILETDKTFASILEIQRELGKLLGALR |
Ga0247824_108697111 | 3300028809 | Soil | VAERIRSEKPSVILETDKTFASILEIQRELGKLLGALR |
Ga0307469_108193271 | 3300031720 | Hardwood Forest Soil | GRNAIGNVADRLKATRPTIILETEKNFAAILEIQRELGKLLGALR |
Ga0307468_1000220281 | 3300031740 | Hardwood Forest Soil | SGQAIEVGRNAIGNVADRLKATRPTIILETEKNFAAILEIQRELGKLLGALR |
Ga0310904_103715181 | 3300031854 | Soil | GRNAIGNVAERIRSEKPAIILETDKTFASILEIQRELGKLLGALR |
Ga0310892_103970342 | 3300031858 | Soil | EVGRNAIGSVAERIKAARPAIILETDKNFTPILEIQRELGKLLGALR |
Ga0310916_115657501 | 3300031942 | Soil | AERIKSEKPSIILETDKTFASILEIQRELGKMLGALR |
Ga0326597_101019521 | 3300031965 | Soil | TGQANEVGRTAIGAVAERIKAAQPAVILETDKTFATILEIQRELGKMLGALR |
Ga0307414_103997702 | 3300032004 | Rhizosphere | MEVGKTAIGNVAERIRNEKPPIILETDKTFTAILEIQREMGKLLGALR |
Ga0316628_1029495832 | 3300033513 | Soil | MEVGRNAIGNVAERIKNQKPAIILETDKTFASILEIQRELGKLLGALR |
Ga0316628_1034750313 | 3300033513 | Soil | KVRYETSGQANEVGKNAIGAVAERIRTARPAIILETDKNFTAILEIQRELGKLLGALR |
Ga0364929_0119715_99_245 | 3300034149 | Sediment | MEVGRNAIGNVAERIRTQKPAIILETDKTFASILEIQRELGKLLGALR |
Ga0364940_0226392_48_194 | 3300034164 | Sediment | MEVGKNAIGAVAERIKAAQPAIILETDKTFATILEIQRELGKMLGALR |
⦗Top⦘ |