NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099056

Metagenome / Metatranscriptome Family F099056

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099056
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 40 residues
Representative Sequence MKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAP
Number of Associated Samples 76
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.96 %
% of genes near scaffold ends (potentially truncated) 35.92 %
% of genes from short scaffolds (< 2000 bps) 74.76 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.495 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil
(25.243 % of family members)
Environment Ontology (ENVO) Unclassified
(66.990 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(80.583 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.82%    β-sheet: 0.00%    Coil/Unstructured: 64.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF02954HTH_8 14.56
PF00582Usp 6.80
PF02518HATPase_c 6.80
PF00072Response_reg 2.91
PF13426PAS_9 2.91
PF08281Sigma70_r4_2 2.91
PF00005ABC_tran 1.94
PF07690MFS_1 1.94
PF00165HTH_AraC 1.94
PF00106adh_short 0.97
PF00149Metallophos 0.97
PF14417MEDS 0.97
PF12680SnoaL_2 0.97
PF02239Cytochrom_D1 0.97
PF00578AhpC-TSA 0.97
PF01593Amino_oxidase 0.97
PF00075RNase_H 0.97
PF04909Amidohydro_2 0.97
PF08402TOBE_2 0.97
PF00326Peptidase_S9 0.97
PF03466LysR_substrate 0.97
PF02515CoA_transf_3 0.97
PF13473Cupredoxin_1 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.50 %
UnclassifiedrootN/A16.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002557|JGI25381J37097_1043377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria752Open in IMG/M
3300002558|JGI25385J37094_10000770All Organisms → cellular organisms → Bacteria9298Open in IMG/M
3300002558|JGI25385J37094_10014087All Organisms → cellular organisms → Bacteria2866Open in IMG/M
3300002558|JGI25385J37094_10022841All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300002561|JGI25384J37096_10165003All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium686Open in IMG/M
3300002561|JGI25384J37096_10252842Not Available514Open in IMG/M
3300002562|JGI25382J37095_10001378All Organisms → cellular organisms → Bacteria7321Open in IMG/M
3300002562|JGI25382J37095_10040322All Organisms → cellular organisms → Bacteria → Proteobacteria1824Open in IMG/M
3300002916|JGI25389J43894_1065433All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005166|Ga0066674_10002545All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium6731Open in IMG/M
3300005166|Ga0066674_10231983All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300005446|Ga0066686_10005268All Organisms → cellular organisms → Bacteria6179Open in IMG/M
3300005446|Ga0066686_10621770All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria734Open in IMG/M
3300005447|Ga0066689_10056245All Organisms → cellular organisms → Bacteria2130Open in IMG/M
3300005451|Ga0066681_10013377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium4050Open in IMG/M
3300005558|Ga0066698_10212180Not Available1327Open in IMG/M
3300005574|Ga0066694_10328025All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium727Open in IMG/M
3300005586|Ga0066691_10162919All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300005713|Ga0066905_100225343All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1421Open in IMG/M
3300005713|Ga0066905_100229446All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1411Open in IMG/M
3300005713|Ga0066905_100836638All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria801Open in IMG/M
3300005713|Ga0066905_100906418All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium772Open in IMG/M
3300005764|Ga0066903_108698741Not Available516Open in IMG/M
3300006031|Ga0066651_10009541All Organisms → cellular organisms → Bacteria3888Open in IMG/M
3300006032|Ga0066696_10984803All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium536Open in IMG/M
3300006791|Ga0066653_10265329All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300006794|Ga0066658_10776055Not Available537Open in IMG/M
3300006797|Ga0066659_10031737All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3169Open in IMG/M
3300006904|Ga0075424_100394163All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1476Open in IMG/M
3300007255|Ga0099791_10019419All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2912Open in IMG/M
3300007255|Ga0099791_10250533Not Available840Open in IMG/M
3300009012|Ga0066710_100001640All Organisms → cellular organisms → Bacteria → Proteobacteria17059Open in IMG/M
3300009012|Ga0066710_102560212All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium735Open in IMG/M
3300009162|Ga0075423_11087609All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria851Open in IMG/M
3300010046|Ga0126384_10050437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2867Open in IMG/M
3300010046|Ga0126384_10159437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1746Open in IMG/M
3300010046|Ga0126384_10408414All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1149Open in IMG/M
3300010046|Ga0126384_10506159All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1042Open in IMG/M
3300010047|Ga0126382_10044327All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2557Open in IMG/M
3300010087|Ga0127492_1031814All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium761Open in IMG/M
3300010102|Ga0127453_1112273All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300010112|Ga0127458_1124116All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010114|Ga0127460_1067200All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium738Open in IMG/M
3300010114|Ga0127460_1155489All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010130|Ga0127493_1148827All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300010140|Ga0127456_1163845All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium617Open in IMG/M
3300010141|Ga0127499_1197434All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium823Open in IMG/M
3300010301|Ga0134070_10006274All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3648Open in IMG/M
3300010301|Ga0134070_10328644Not Available589Open in IMG/M
3300010304|Ga0134088_10262984All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300010325|Ga0134064_10037649All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1444Open in IMG/M
3300010329|Ga0134111_10013619All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2643Open in IMG/M
3300010337|Ga0134062_10031174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2101Open in IMG/M
3300010360|Ga0126372_10454962All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1188Open in IMG/M
3300011269|Ga0137392_10578067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria933Open in IMG/M
3300011271|Ga0137393_11094743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria677Open in IMG/M
3300012189|Ga0137388_10180875All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300012198|Ga0137364_10943562All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium653Open in IMG/M
3300012199|Ga0137383_10282298All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300012200|Ga0137382_11114504Not Available563Open in IMG/M
3300012379|Ga0134058_1006116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium908Open in IMG/M
3300012379|Ga0134058_1215441All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300012380|Ga0134047_1061602All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria531Open in IMG/M
3300012396|Ga0134057_1262558All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium930Open in IMG/M
3300012399|Ga0134061_1072352All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012401|Ga0134055_1013589All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300012401|Ga0134055_1125206All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300012927|Ga0137416_11604525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300012930|Ga0137407_10212139All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1742Open in IMG/M
3300012948|Ga0126375_10129434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41555Open in IMG/M
3300012971|Ga0126369_12299795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria626Open in IMG/M
3300012976|Ga0134076_10317471Not Available678Open in IMG/M
3300012977|Ga0134087_10377963All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria684Open in IMG/M
3300017657|Ga0134074_1366189Not Available534Open in IMG/M
3300017659|Ga0134083_10013693All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2769Open in IMG/M
3300017659|Ga0134083_10095881All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1165Open in IMG/M
3300018431|Ga0066655_10001910All Organisms → cellular organisms → Bacteria7700Open in IMG/M
3300018431|Ga0066655_10005858All Organisms → cellular organisms → Bacteria5033Open in IMG/M
3300018431|Ga0066655_11185247Not Available540Open in IMG/M
3300018433|Ga0066667_10075976All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2145Open in IMG/M
3300018433|Ga0066667_11597531Not Available580Open in IMG/M
3300018468|Ga0066662_10046357All Organisms → cellular organisms → Bacteria2734Open in IMG/M
3300018468|Ga0066662_12282715Not Available568Open in IMG/M
3300018482|Ga0066669_10016227All Organisms → cellular organisms → Bacteria4005Open in IMG/M
3300018482|Ga0066669_10398188All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1165Open in IMG/M
3300026277|Ga0209350_1066368All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1017Open in IMG/M
3300026295|Ga0209234_1145574Not Available845Open in IMG/M
3300026296|Ga0209235_1021003All Organisms → cellular organisms → Bacteria3487Open in IMG/M
3300026296|Ga0209235_1056737All Organisms → cellular organisms → Bacteria → Proteobacteria1852Open in IMG/M
3300026297|Ga0209237_1057251All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1916Open in IMG/M
3300026310|Ga0209239_1216064Not Available675Open in IMG/M
3300026331|Ga0209267_1136051All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1025Open in IMG/M
3300026528|Ga0209378_1004326All Organisms → cellular organisms → Bacteria9398Open in IMG/M
3300026540|Ga0209376_1107762All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1411Open in IMG/M
3300027655|Ga0209388_1151715Not Available654Open in IMG/M
3300027874|Ga0209465_10604116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300027875|Ga0209283_10190451All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300031720|Ga0307469_10468954All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1095Open in IMG/M
3300031820|Ga0307473_10427893All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria875Open in IMG/M
3300031820|Ga0307473_10499192Not Available821Open in IMG/M
3300032180|Ga0307471_100348078All Organisms → cellular organisms → Bacteria → Proteobacteria1591Open in IMG/M
3300032180|Ga0307471_102238125Not Available689Open in IMG/M
3300032205|Ga0307472_100407580All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1140Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil25.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil25.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010112Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010130Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012380Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25381J37097_104337723300002557Grasslands SoilMKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP*
JGI25385J37094_1000077053300002558Grasslands SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP*
JGI25385J37094_1001408723300002558Grasslands SoilMKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP*
JGI25385J37094_1002284133300002558Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP*
JGI25384J37096_1016500313300002561Grasslands SoilMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP*
JGI25384J37096_1025284223300002561Grasslands SoilNEGGEEMKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP*
JGI25382J37095_1000137883300002562Grasslands SoilMKRLGIAMLLVLVALSGVGAAWAFNDDPPLTGPDSIQAP*
JGI25382J37095_1004032223300002562Grasslands SoilMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP*
JGI25389J43894_106543313300002916Grasslands SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAXQAP*
Ga0066674_1000254533300005166SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP*
Ga0066674_1023198323300005166SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP*
Ga0066686_1000526853300005446SoilMKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP*
Ga0066686_1062177023300005446SoilMKRFAIATLLAVLALGGVGTAWAFNDDTPLTGPDSIQAP*
Ga0066689_1005624543300005447SoilPQKRFGVAMLLVLVALSGVGGAWAFNDDPPLTGPDSIQAP*
Ga0066681_1001337753300005451SoilREGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP*
Ga0066698_1021218023300005558SoilMKHFGIAVLLALVALSGVGAAWAFNEDPPLTGPDSIQAP*
Ga0066694_1032802523300005574SoilMKRLGIALLLVLAALRGAGAAWAFNDDPPLTGPDSIQAP*
Ga0066691_1016291923300005586SoilRSERGGECMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP*
Ga0066905_10022534333300005713Tropical Forest SoilMKRFAIVTLLALVALSGVGTAWAFNDDVPLTGPDSIQAP*
Ga0066905_10022944623300005713Tropical Forest SoilMVKKLSIALLLALVALSGVGTSWAFNDDTLLTGPDSIQAP*
Ga0066905_10083663823300005713Tropical Forest SoilMKRFALATLLALVAVSGVGTAWAFNDDIPLTGPDSVQAP*
Ga0066905_10090641833300005713Tropical Forest SoilMKRFGIALLLALVTLSGVGTASAFNDDTPLTGPDSIQAP*
Ga0066903_10869874123300005764Tropical Forest SoilMKHFTIAFLLALVAVSGVVGTASAYNDDPPISGPDSVQAP*
Ga0066651_1000954143300006031SoilMKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQAP*
Ga0066696_1098480323300006032SoilRRAQQRGEEMKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP*
Ga0066653_1026532923300006791SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAMQAP*
Ga0066658_1077605523300006794SoilMKRLGIAMPLILVALSGAGAAWAFNDDPPLTGPDSLQAP*
Ga0066659_1003173743300006797SoilTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP*
Ga0075424_10039416323300006904Populus RhizosphereMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSIQAP*
Ga0099791_1001941933300007255Vadose Zone SoilMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP*
Ga0099791_1025053313300007255Vadose Zone SoilMKRFGIAMLLVLVALSGVGAAWAFNDDTPLTGPDSIQAP*
Ga0066710_10000164073300009012Grasslands SoilMKHFGIAVLLALVALSGVGAAWAFNEDPPLTGPDSIQAP
Ga0066710_10256021213300009012Grasslands SoilREGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP
Ga0075423_1108760913300009162Populus RhizosphereMKRFAIATLLAVLALGGVGTAWAFNDDTPLTGPDSIQA
Ga0126384_1005043743300010046Tropical Forest SoilMKRFAIATLLVLVALGGAGTAWAFNDDTPLTGPDSIQAP*
Ga0126384_1015943733300010046Tropical Forest SoilKKLSIALLLALVALSGVGTSWAFNDDTLLTGPDSIQAP*
Ga0126384_1040841413300010046Tropical Forest SoilMKRFALATLLALVALSGIGTAWAFNDDIPLTGPDSVQAP*
Ga0126384_1050615933300010046Tropical Forest SoilKRFAIVTLLALVALSGVGTAWAFNDDVPLTGPDSIQAP*
Ga0126382_1004432753300010047Tropical Forest SoilMKRFALATLLALVALSGVGTAWAFNDDIPLTGLDSVQAP*
Ga0127492_103181423300010087Grasslands SoilERQVRNMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP*
Ga0127453_111227323300010102Grasslands SoilMKRFGIALLLALVALGGVGTASAYNDDSPVSGPDAIQAP*
Ga0127458_112411613300010112Grasslands SoilMKRLGIALLLVLVALRGAGAALAFNDDPPLTGPDSIQAP*
Ga0127460_106720013300010114Grasslands SoilGPVASKEVERQVRNMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP*
Ga0127460_115548923300010114Grasslands SoilECMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP*
Ga0127493_114882713300010130Grasslands SoilGECMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP*
Ga0127456_116384513300010140Grasslands SoilKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP*
Ga0127499_119743413300010141Grasslands SoilMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDS
Ga0134070_1000627443300010301Grasslands SoilMKRFALATLLALVALSGVGTAWAFNDDIPLTGPDSVQAP*
Ga0134070_1032864413300010301Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQ
Ga0134088_1026298413300010304Grasslands SoilMKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP*
Ga0134064_1003764923300010325Grasslands SoilMKRFALATLLALVALSGVGIAWAFNDDNPLTGADSVQAP*
Ga0134111_1001361923300010329Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSRPGALTSA*
Ga0134062_1003117443300010337Grasslands SoilMMKKLSIAFLLAVVALSGVCTSWAFNDDTPLTGPDSVQAP*
Ga0126372_1045496223300010360Tropical Forest SoilMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAP*
Ga0137392_1057806713300011269Vadose Zone SoilMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP*
Ga0137393_1109474313300011271Vadose Zone SoilERGDEMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP*
Ga0137388_1018087523300012189Vadose Zone SoilVRERGDEMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP*
Ga0137364_1094356233300012198Vadose Zone SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQ
Ga0137383_1028229843300012199Vadose Zone SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSVQAP*
Ga0137382_1111450423300012200Vadose Zone SoilRRRKGREGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP*
Ga0134058_100611623300012379Grasslands SoilMKRFGIALLLALVALSGVGTASAFNDDTPPTGPDSVQAP*
Ga0134058_121544123300012379Grasslands SoilMKRFGIALLLALVALSGVGTASAYNDDTPVSGPDAIQAP*
Ga0134047_106160213300012380Grasslands SoilEMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP*
Ga0134057_126255823300012396Grasslands SoilMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP*
Ga0134061_107235223300012399Grasslands SoilGECMKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP*
Ga0134055_101358923300012401Grasslands SoilCMKRFGIALLLALVALGGVGTASAYNDDSPVSGPDAIQAP*
Ga0134055_112520623300012401Grasslands SoilECMKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP*
Ga0137416_1160452513300012927Vadose Zone SoilMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSVQAP*
Ga0137407_1021213943300012930Vadose Zone SoilRRRRKGREGVRMMKKLRIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP*
Ga0126375_1012943423300012948Tropical Forest SoilMKQLGIAVLLALVALGGVGTASAYNDDTPISGPDAIQAP*
Ga0126369_1229979523300012971Tropical Forest SoilMKRFAIATLLVLVALGGVGTAWAFNDDTPLTGPDSIQAP*
Ga0134076_1031747113300012976Grasslands SoilMKHFGIAMLLALVALSSVGAAWAFNEDPPLTGPDSIQAP*
Ga0134087_1037796333300012977Grasslands SoilMKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAI
Ga0134074_136618913300017657Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDS
Ga0134083_1001369333300017659Grasslands SoilMKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQAP
Ga0134083_1009588123300017659Grasslands SoilMKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP
Ga0066655_10001910103300018431Grasslands SoilMKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP
Ga0066655_1000585863300018431Grasslands SoilMKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP
Ga0066655_1118524713300018431Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP
Ga0066667_1007597643300018433Grasslands SoilMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP
Ga0066667_1159753113300018433Grasslands SoilREGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP
Ga0066662_1004635713300018468Grasslands SoilSERGGECMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP
Ga0066662_1228271523300018468Grasslands SoilVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP
Ga0066669_1001622763300018482Grasslands SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP
Ga0066669_1039818813300018482Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP
Ga0209350_106636823300026277Grasslands SoilARDERGDEMKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP
Ga0209234_114557423300026295Grasslands SoilVNGVIAAVLLALVALSGVGTAWAFNDDNPLTGPDSVQAP
Ga0209235_102100363300026296Grasslands SoilMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP
Ga0209235_105673723300026296Grasslands SoilMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP
Ga0209237_105725133300026297Grasslands SoilMKRLGIAMLLVLVALSGVGAAWAFNDDPPLTGPDSIQAP
Ga0209239_121606413300026310Grasslands SoilMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDS
Ga0209267_113605133300026331SoilTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP
Ga0209378_100432613300026528SoilMKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQA
Ga0209376_110776233300026540SoilGVRTGGDEMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP
Ga0209388_115171513300027655Vadose Zone SoilMKRFGIAMLLVLVALSGVGAAWAFNDDTPLTGPDSIQAP
Ga0209465_1060411613300027874Tropical Forest SoilFGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAS
Ga0209283_1019045133300027875Vadose Zone SoilMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP
Ga0307469_1046895423300031720Hardwood Forest SoilMKKLSIALLFALVALTGIAATASAYNDDPPISGPDSVQAP
Ga0307473_1042789323300031820Hardwood Forest SoilMKRFVLATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP
Ga0307473_1049919223300031820Hardwood Forest SoilMKKLSIALLLALVALSGVGTSWAFNDDDTPVTGPDAVQAP
Ga0307471_10034807833300032180Hardwood Forest SoilMKKFTIAFLLALVALSGVVGTASAYNDDPPISGPDSVQAP
Ga0307471_10223812513300032180Hardwood Forest SoilMKHFVLATLLVLVAFGGVGTAWAFNDDPPLTGPDS
Ga0307472_10040758033300032205Hardwood Forest SoilMKKLSIALLLALVALSGVGTSWAFNDDTPLTGPDSVQAP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.