Basic Information | |
---|---|
Family ID | F099098 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFRIIPRWLI |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.08 % |
% of genes near scaffold ends (potentially truncated) | 99.03 % |
% of genes from short scaffolds (< 2000 bps) | 90.29 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.029 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.097 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.155 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.165 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 52.43 |
PF01066 | CDP-OH_P_transf | 0.97 |
PF02371 | Transposase_20 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.97 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.97 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.03 % |
Unclassified | root | N/A | 0.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002914|JGI25617J43924_10063373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300003224|JGI26344J46810_1001304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
3300003350|JGI26347J50199_1017649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300004152|Ga0062386_101387188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300004635|Ga0062388_100787969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
3300005166|Ga0066674_10044495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1991 | Open in IMG/M |
3300005166|Ga0066674_10483040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005171|Ga0066677_10171919 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300005174|Ga0066680_10586447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300005175|Ga0066673_10283734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300005332|Ga0066388_102317869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
3300005332|Ga0066388_108477201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300005434|Ga0070709_10399126 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300005560|Ga0066670_10539095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300005568|Ga0066703_10272038 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300006162|Ga0075030_101606456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300006755|Ga0079222_10244644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300006806|Ga0079220_10678348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300006806|Ga0079220_11778054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300007265|Ga0099794_10012003 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
3300009088|Ga0099830_10877210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300009089|Ga0099828_10263920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
3300009137|Ga0066709_103618022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300010301|Ga0134070_10012657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2676 | Open in IMG/M |
3300010321|Ga0134067_10163862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300010333|Ga0134080_10540765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300010337|Ga0134062_10113895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
3300010337|Ga0134062_10225881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300010358|Ga0126370_10907984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300010360|Ga0126372_11255143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300010361|Ga0126378_10052413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3810 | Open in IMG/M |
3300010366|Ga0126379_11020218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300010877|Ga0126356_11385810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300011269|Ga0137392_11265520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300011270|Ga0137391_11130407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300011271|Ga0137393_10323060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
3300012096|Ga0137389_10833614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300012096|Ga0137389_11153618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300012205|Ga0137362_10841281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300012207|Ga0137381_10408125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
3300012209|Ga0137379_10296257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1528 | Open in IMG/M |
3300012209|Ga0137379_11421119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300012351|Ga0137386_10671819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300012361|Ga0137360_10785421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300012582|Ga0137358_10460620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300012685|Ga0137397_10092976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2204 | Open in IMG/M |
3300012918|Ga0137396_10080229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2296 | Open in IMG/M |
3300012918|Ga0137396_10481290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300012918|Ga0137396_11082473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300012923|Ga0137359_10647458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300012923|Ga0137359_11411126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300012924|Ga0137413_10567876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300012925|Ga0137419_11757911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300012927|Ga0137416_10850824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300012927|Ga0137416_11722723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300012929|Ga0137404_11735552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300014154|Ga0134075_10161573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
3300017657|Ga0134074_1107110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300017659|Ga0134083_10353868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300017659|Ga0134083_10580368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300017959|Ga0187779_10271061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
3300018085|Ga0187772_10581912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300018482|Ga0066669_10958559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300019789|Ga0137408_1319911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300020579|Ga0210407_10033392 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
3300020579|Ga0210407_10474891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300020579|Ga0210407_11235928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300020583|Ga0210401_10693231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300021171|Ga0210405_10385771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300021171|Ga0210405_10526050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
3300021171|Ga0210405_10854644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300021405|Ga0210387_11695775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300021478|Ga0210402_10415402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
3300021479|Ga0210410_10637823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300021559|Ga0210409_10076189 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
3300021560|Ga0126371_13740934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300026297|Ga0209237_1244330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300026301|Ga0209238_1016693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2834 | Open in IMG/M |
3300026309|Ga0209055_1077350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
3300026309|Ga0209055_1266654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300026331|Ga0209267_1082979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
3300026482|Ga0257172_1051574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300026547|Ga0209156_10242439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300026550|Ga0209474_10552224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300027064|Ga0208724_1009928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 908 | Open in IMG/M |
3300027460|Ga0207506_1009351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300027512|Ga0209179_1040521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300027645|Ga0209117_1153902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300027669|Ga0208981_1155945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300027698|Ga0209446_1060685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300027725|Ga0209178_1150438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300027862|Ga0209701_10337413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300027874|Ga0209465_10103820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
3300027903|Ga0209488_10656058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300027903|Ga0209488_10726155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300031247|Ga0265340_10063750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1758 | Open in IMG/M |
3300031715|Ga0307476_10487912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300031753|Ga0307477_10994999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300031754|Ga0307475_10658139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300031859|Ga0318527_10382282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300031894|Ga0318522_10063080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
3300031962|Ga0307479_10080535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3151 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.74% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12627J18819_105007091 | 3300001867 | Forest Soil | MTDYAQRASNSFNERMRLIRFRRKRENLRFWDEFKLVPRWLVALVILLFI |
JGI25617J43924_100633733 | 3300002914 | Grasslands Soil | MTDYTQRVSDSFNERMRLIRFRRKREKLRFWDEFKLVPRWLVAVVI |
JGI26344J46810_10013041 | 3300003224 | Bog Forest Soil | MSDYQQKVSGTFNERMKLIRLRRKKENLRFWDEFRIVPRWLVWG |
JGI26347J50199_10176491 | 3300003350 | Bog Forest Soil | MSEYQQKVAGSFNERMKLIKLRRKKENLRFWDEFRIIPKG |
Ga0062386_1013871882 | 3300004152 | Bog Forest Soil | MTDYPQRVTESINERSRLYRLRKRKEKLRFWHEFGIIPRWLKVLV |
Ga0062388_1007879692 | 3300004635 | Bog Forest Soil | MSEYQQKVAGSFNERMKLIKLRRKKENLRFWDEFRIIPKGLIWTVV |
Ga0066674_100444954 | 3300005166 | Soil | MTDYPQRVSDSFYERKRLIRLRRKKENLRFWEEFRIIPRWLTALV |
Ga0066674_104830402 | 3300005166 | Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIPRW |
Ga0066677_101719193 | 3300005171 | Soil | MTDYPQRVSDSFYERKRLIRLRRKKENLRFWEEFRIIPRWLMALVA |
Ga0066680_105864471 | 3300005174 | Soil | MSDYQQRIAGSFQERKRLNQLRKRKETLRLWSEFRIIPLWLIVLVIVLF |
Ga0066673_102837341 | 3300005175 | Soil | MADYSQKVTSSFNERMRLMRVRRKKEKLRFADEFRIIPRWLIVLVIV |
Ga0066388_1023178691 | 3300005332 | Tropical Forest Soil | MSDYSQKVAGSFNERMRLIRVRRKKENLRFWDEFRIIPRW |
Ga0066388_1084772012 | 3300005332 | Tropical Forest Soil | MADYSQKVTSSFNERMRLMRVRRKKERLRFADEFRIIPRWLI |
Ga0070709_103991263 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDYQQKVSGSFNERMRLIRLRRKKENLRFWEEFRIIPKGVIW |
Ga0066670_105390951 | 3300005560 | Soil | MSDYSQKVTGSFNERMRLNRLRRRKEKLRFWSEFLIIPKWLMGLVA |
Ga0066703_102720381 | 3300005568 | Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPR |
Ga0075030_1016064562 | 3300006162 | Watersheds | VSDYQQKIAETFNERKRLNQLRRRKENLRFWNELRIIPRSLFVLVAV |
Ga0079222_102446441 | 3300006755 | Agricultural Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIPRWLMALVAL |
Ga0079220_106783481 | 3300006806 | Agricultural Soil | MADYSQKVTSTFNERMRLNRVRRRKEKLRFWDEFM |
Ga0079220_117780541 | 3300006806 | Agricultural Soil | MSEYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGII |
Ga0099794_100120031 | 3300007265 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFR |
Ga0099830_108772101 | 3300009088 | Vadose Zone Soil | MSDYSQRVTGSLNERMRLIRLRRKKENLRFWEEFRII |
Ga0099828_102639204 | 3300009089 | Vadose Zone Soil | MTDYQQKVSDSFNERKRLIRLRRKKENLRFWDEFRIIP |
Ga0066709_1036180222 | 3300009137 | Grasslands Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPRWLIVLVI |
Ga0134070_100126575 | 3300010301 | Grasslands Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIP |
Ga0134067_101638622 | 3300010321 | Grasslands Soil | MADYSQKVTSSFNERMRLNRVRRRKEKLRFWDELLIIPKWLLVV |
Ga0134080_105407651 | 3300010333 | Grasslands Soil | MSDYSQKVTGSFNERMRLNRLRRRKEKLRFWSEFLIIPKWL |
Ga0134062_101138953 | 3300010337 | Grasslands Soil | MSDYSQKVTGSFNERMRLNRLRRRKEKLRFWSEFLIIPKWLMG |
Ga0134062_102258813 | 3300010337 | Grasslands Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIPRWLVVLVALLYVI |
Ga0126370_109079842 | 3300010358 | Tropical Forest Soil | MADYSQKVTSTFNERLRLNRVRRRKEKLRFWDEFRIIPRWVMVLVVVLFLLA |
Ga0126372_112551431 | 3300010360 | Tropical Forest Soil | MADYSQKVTSSFNERMRLMRVRRKKERLHFSEEFRIIPRWLIVL |
Ga0126378_100524136 | 3300010361 | Tropical Forest Soil | MADYSQKVTSTFNERLRLNRVRRRKEKLRFWDEFRIIP |
Ga0126379_110202183 | 3300010366 | Tropical Forest Soil | MADYSQKVTSSFNERMRLMRVRRKKERLRFADEFRIIPRWLIAVVMV |
Ga0126356_113858101 | 3300010877 | Boreal Forest Soil | MSDTQQKVTGTFNERMRLIRLRRKKENLRFWEEFRIIPNGVIWTV |
Ga0137392_112655202 | 3300011269 | Vadose Zone Soil | MSDYQQRIAESFQERKRLNQLRKRKENLRFWSEFRIIPRWLIVLVI |
Ga0137391_111304071 | 3300011270 | Vadose Zone Soil | MSDYSQRVTGSLNERMRLIRLRRKKENLRFWQELRIIPRPLGGPVAAT |
Ga0137393_103230601 | 3300011271 | Vadose Zone Soil | MSDYSQRVTGSLNERMRLIRLRRKKENLRFWEEFRIIPRWL |
Ga0137389_108336141 | 3300012096 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRI |
Ga0137389_111536181 | 3300012096 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFRIIPRWLIVLV |
Ga0137362_108412811 | 3300012205 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPRWLIVL |
Ga0137381_104081251 | 3300012207 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFRDEFR |
Ga0137379_102962573 | 3300012209 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWNEFLLIPRWLMGTVAALF |
Ga0137379_114211191 | 3300012209 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFRIIPRWLIVLVILLFLL |
Ga0137386_106718191 | 3300012351 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFRDEFRIIPRWLIVLVI |
Ga0137360_107854212 | 3300012361 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPRWLI |
Ga0137358_104606203 | 3300012582 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPRWLIVLVIV |
Ga0137397_100929764 | 3300012685 | Vadose Zone Soil | MTDYPQRMTDSFNERKRLIRLRWKKENLRFWDEFGIIPRWLK |
Ga0137396_100802291 | 3300012918 | Vadose Zone Soil | MSDYQQRIAESLQERKRLNQLRRRKEKLSFWDEFQIIPRWLVVLVVVLYVMAL |
Ga0137396_104812903 | 3300012918 | Vadose Zone Soil | MSDYSQRVSGSFNERMRLIRLRRKKENLRFWSEFRIIPRW |
Ga0137396_110824731 | 3300012918 | Vadose Zone Soil | MSDYPQRVTDSFNERKRLIRLRRKKENLRFWEEFR |
Ga0137359_106474581 | 3300012923 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRKRKENLRFWSEFRIIPRWLIVLVIVLFFAAQ |
Ga0137359_114111261 | 3300012923 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFRDEFRIIPR |
Ga0137413_105678761 | 3300012924 | Vadose Zone Soil | MSDYSQGVTGSLNERMRLIRLRRKKENLRFWQEFRI |
Ga0137419_117579111 | 3300012925 | Vadose Zone Soil | VSDYQQKIAESFSERKRLNQLRKRKENLRFWNELRIIPRW |
Ga0137416_108508241 | 3300012927 | Vadose Zone Soil | MTDYPQRVTSSWNERMRLIRLRRKKENLHFWEEFGIIPGWLKALVAFLYVAA |
Ga0137416_117227231 | 3300012927 | Vadose Zone Soil | MSDYSQRVTGSFNERMRLIRLRRKKENLRFWEEFGIIPR |
Ga0137404_117355521 | 3300012929 | Vadose Zone Soil | MTDYPQRMTDSFNERKRLIRLRRKKENLRFWDEFAIIPRWLKVL |
Ga0134075_101615731 | 3300014154 | Grasslands Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFRIIPRWLI |
Ga0134074_11071103 | 3300017657 | Grasslands Soil | MSDYSQKVTGSFNERMRLNRLRRRKEKLRFWSEFLIIPK |
Ga0134083_103538682 | 3300017659 | Grasslands Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGI |
Ga0134083_105803681 | 3300017659 | Grasslands Soil | MSDYQQRVTDSFNERRRLIRLRRKKENLRFWQEFGIIPRWL |
Ga0187779_102710613 | 3300017959 | Tropical Peatland | MPDYSQRVAESFNERMRLNRLRRRKENLKFWDEFRIIPRWLMVLVVILYA |
Ga0187772_105819121 | 3300018085 | Tropical Peatland | MNEWRKEREMSDYSQKVSSSFNERMRLIRLRRKKENLRFRDEFLIIPRWLMILVGV |
Ga0066669_109585591 | 3300018482 | Grasslands Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIPRWL |
Ga0137408_13199111 | 3300019789 | Vadose Zone Soil | MSDYQQRIAGSFQERKRLNQLRRKKEKLRFWSEFRIIPRWLIVLVI |
Ga0210407_100333926 | 3300020579 | Soil | MSDYQQKVSASFNERKRLNRLRRRKENLRFWDEFSIIPRWLVASVFVLFLI |
Ga0210407_104748913 | 3300020579 | Soil | MSDYQQKIAESFNERKRLNQLRRRKEKLHFWNEFRIIPRWLVGLV |
Ga0210407_112359282 | 3300020579 | Soil | VSDYQQKIAETFSERKRLNQLRKRKENLRFWNELRIIPRWLFVLVAA |
Ga0210401_106932311 | 3300020583 | Soil | MSDYQQKVSGSFNERMRLIRLRRKKENLRFWDEFRIVPRGLIWTMV |
Ga0210405_103857713 | 3300021171 | Soil | MSDYQQKVSGSFNERMRLIRLRRKKENLRFWDEFR |
Ga0210405_105260503 | 3300021171 | Soil | MSDYQQKIAESLNERKRLNQLRRRKEKLRFWSEFGIIPRW |
Ga0210405_108546442 | 3300021171 | Soil | MTDYPQKVSDSFNERVRLIRLRRKKENLSFWQEFRIIPRWLVVLVIF |
Ga0210387_116957752 | 3300021405 | Soil | MSDYQQKVSGSFSERKRLNRLRRRKEKLRFWEEFRIVPRWL |
Ga0210402_104154023 | 3300021478 | Soil | MSDYPQRMTDSFNERKRLIRLRRKKENLRFWEEFRIVPN |
Ga0210410_106378233 | 3300021479 | Soil | MSDYQQKIAESFNERKRLNQLRRRKEKLRFWSEFGIIPRWLIGLVIVLYV |
Ga0210409_100761891 | 3300021559 | Soil | MSDYQQKVSGSFNERMRLIRLRRKKENLRFWEEFRII |
Ga0126371_137409342 | 3300021560 | Tropical Forest Soil | MADYSQKVTSTFNERLRLNRVRRRKEKLRFWDEFRIIPRWVMVLVVVLFL |
Ga0209237_12443302 | 3300026297 | Grasslands Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFLIIPRWLMIVVGVLYAIAL |
Ga0209238_10166935 | 3300026301 | Grasslands Soil | MSDYPQRVTDSFNERKRLIRLRRKKENLRFWEEFRIIPRWLLIS |
Ga0209055_10773501 | 3300026309 | Soil | MSDYPQRVTDSFNERKRLIRLRRKKENLRFWEEFRIIPRWLMALVAI |
Ga0209055_12666542 | 3300026309 | Soil | MADYSQKVTSTFNERMRLNRVRRRKEKLRFRDEFRIIPKWL |
Ga0209267_10829793 | 3300026331 | Soil | MSDYQQRVTDSFNERKRLIRLRRRKENLRFWQEFGIIPRWLIILVIVLF |
Ga0257172_10515743 | 3300026482 | Soil | MSDYSQRVSGSFNERKRLIRLRRKKENLRFWEEFRIIP |
Ga0209156_102424393 | 3300026547 | Soil | MADYSQKVAGSFNERMRLNRVRRRKEKLRFWEEFRIIPRWLVGLVVVLFFIAQG |
Ga0209474_105522241 | 3300026550 | Soil | MADYSQKVTSSFNERMRLMRVRRKKEKLRFADEFRIIPR |
Ga0208724_10099283 | 3300027064 | Forest Soil | MSDYQQKVSGSFNERMRLIRLRRKKENLRFWDEFRIVPRGLIWIMVA |
Ga0207506_10093511 | 3300027460 | Soil | MSDYQQKVSGSFNERMRLNRLRRKKEKLRFWQEFRIVPKGLIWT |
Ga0209179_10405213 | 3300027512 | Vadose Zone Soil | MTDYPQRVTDSFNERKRLIRLRRKKENLRFWEEFGIIPGWLKVLV |
Ga0209117_11539022 | 3300027645 | Forest Soil | MSDYQQRVSGSFSERVRLIRFRRKKEKTRLRDEWRIVPRWLA |
Ga0208981_11559451 | 3300027669 | Forest Soil | MSDYSQRVSGSFNERKRLIRLRRKKENLRFWEEFRIIPRWLMALVAILYVL |
Ga0209446_10606851 | 3300027698 | Bog Forest Soil | MSDYQQKVSGTFNERMKLIRLRRKKENLRFWDEFRIVPR |
Ga0209178_11504381 | 3300027725 | Agricultural Soil | MADYSQKVTSTFNERMRLNRVRRRKEKLRFWDEFMIIPKWLTGLVALLYVT |
Ga0209701_103374133 | 3300027862 | Vadose Zone Soil | MSDYSQKVTSSFNERMRLIRLRRKKENLRFWDEFRIIPRWLIVLVI |
Ga0209465_101038201 | 3300027874 | Tropical Forest Soil | MADYSQKVTSTFNERLRLNRVRRRKEKLRFWDEFRIIPRWVM |
Ga0209488_106560581 | 3300027903 | Vadose Zone Soil | MTDYPQRVSDSFYERKRLIRLRRKKENLRFWEEFRIIPRW |
Ga0209488_107261552 | 3300027903 | Vadose Zone Soil | MTDYQQKVSDSFNERMRLIRLRRKKENLRFWDEFRIIPRWL |
Ga0265340_100637501 | 3300031247 | Rhizosphere | MSDYQQKVSGTLNERMRLIRLRRKKEHLRFWEEFR |
Ga0307476_104879121 | 3300031715 | Hardwood Forest Soil | MSDYQQKIAESFNERKRLNQLRKRKENLRFWNELRIIPRWLMVLVALLYVIAVIIA |
Ga0307477_109949991 | 3300031753 | Hardwood Forest Soil | MTDYAQRASNSFNERMRLIRFRRKRENLRFWDEFKL |
Ga0307475_106581391 | 3300031754 | Hardwood Forest Soil | MSDYQQKVSTSFNERKRLNRLRRRKENLRFWDEFSIVPRWLVA |
Ga0318527_103822822 | 3300031859 | Soil | MADYSQKVTSSFNERMRLMRVRRKKEKLHFADEFRIIPRWLIALVIV |
Ga0318522_100630803 | 3300031894 | Soil | MADYSQKVTSSFNERMRLMRVRRKKEKLHFADEFRIIPRWLIALV |
Ga0307479_100805354 | 3300031962 | Hardwood Forest Soil | MTDYAQRASNSFNERMRLIRFRRKRENLRFWDEFKLVP |
⦗Top⦘ |