NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099132

Metagenome Family F099132

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099132
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 54 residues
Representative Sequence MNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Number of Associated Samples 89
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 66.02 %
% of genes near scaffold ends (potentially truncated) 34.95 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (61.165 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(33.981 % of family members)
Environment Ontology (ENVO) Unclassified
(91.262 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.146 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.55%    β-sheet: 0.00%    Coil/Unstructured: 45.45%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03237Terminase_6N 1.94
PF16190E1_FCCH 0.97
PF11171DUF2958 0.97
PF12236Head-tail_con 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A61.17 %
All OrganismsrootAll Organisms38.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10058802Not Available1862Open in IMG/M
3300000101|DelMOSum2010_c10093978Not Available1272Open in IMG/M
3300000115|DelMOSum2011_c10094882Not Available994Open in IMG/M
3300000115|DelMOSum2011_c10123935Not Available804Open in IMG/M
3300000116|DelMOSpr2010_c10155196Not Available779Open in IMG/M
3300000117|DelMOWin2010_c10045059All Organisms → Viruses1997Open in IMG/M
3300000117|DelMOWin2010_c10179426Not Available669Open in IMG/M
3300001355|JGI20158J14315_10160503All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300001460|JGI24003J15210_10144887Not Available616Open in IMG/M
3300001472|JGI24004J15324_10028115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P1852Open in IMG/M
3300001472|JGI24004J15324_10138551Not Available576Open in IMG/M
3300001472|JGI24004J15324_10147318Not Available548Open in IMG/M
3300001589|JGI24005J15628_10038849All Organisms → Viruses → environmental samples → uncultured marine virus1928Open in IMG/M
3300001740|JGI24656J20076_1000093Not Available26604Open in IMG/M
3300002482|JGI25127J35165_1067868All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300002483|JGI25132J35274_1065977Not Available764Open in IMG/M
3300003478|JGI26238J51125_1048945Not Available872Open in IMG/M
3300004461|Ga0066223_1211372Not Available555Open in IMG/M
3300005747|Ga0076924_1106339Not Available666Open in IMG/M
3300006027|Ga0075462_10061982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1181Open in IMG/M
3300006735|Ga0098038_1150728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium775Open in IMG/M
3300006737|Ga0098037_1031680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1946Open in IMG/M
3300006737|Ga0098037_1090926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1064Open in IMG/M
3300006737|Ga0098037_1201707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P651Open in IMG/M
3300006752|Ga0098048_1022626Not Available2097Open in IMG/M
3300006803|Ga0075467_10359073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P764Open in IMG/M
3300006810|Ga0070754_10263350Not Available784Open in IMG/M
3300006916|Ga0070750_10320114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P659Open in IMG/M
3300006919|Ga0070746_10088091Not Available1561Open in IMG/M
3300006919|Ga0070746_10483761Not Available546Open in IMG/M
3300006921|Ga0098060_1187996Not Available566Open in IMG/M
3300006922|Ga0098045_1132115Not Available580Open in IMG/M
3300007229|Ga0075468_10111221Not Available858Open in IMG/M
3300007276|Ga0070747_1328586Not Available524Open in IMG/M
3300008217|Ga0114899_1137770Not Available801Open in IMG/M
3300008218|Ga0114904_1004586Not Available5497Open in IMG/M
3300008219|Ga0114905_1046634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1607Open in IMG/M
3300008220|Ga0114910_1058535Not Available1217Open in IMG/M
3300009428|Ga0114915_1183460Not Available582Open in IMG/M
3300009603|Ga0114911_1012432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C1653016Open in IMG/M
3300010148|Ga0098043_1063937Not Available1108Open in IMG/M
3300010150|Ga0098056_1014482Not Available2856Open in IMG/M
3300011013|Ga0114934_10120851All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300012919|Ga0160422_10537668Not Available737Open in IMG/M
3300012920|Ga0160423_10461338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C165865Open in IMG/M
3300012953|Ga0163179_10472260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P1032Open in IMG/M
3300017706|Ga0181377_1048225All Organisms → Viruses → environmental samples → uncultured Mediterranean phage823Open in IMG/M
3300017708|Ga0181369_1100911Not Available600Open in IMG/M
3300017738|Ga0181428_1155172Not Available535Open in IMG/M
3300017755|Ga0181411_1177484Not Available605Open in IMG/M
3300017757|Ga0181420_1080124Not Available1019Open in IMG/M
3300017757|Ga0181420_1101938Not Available882Open in IMG/M
3300017764|Ga0181385_1030220Not Available1716Open in IMG/M
3300017770|Ga0187217_1163142Not Available744Open in IMG/M
3300017773|Ga0181386_1020367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2214Open in IMG/M
3300017775|Ga0181432_1092539All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium894Open in IMG/M
3300017781|Ga0181423_1350224Not Available538Open in IMG/M
3300018416|Ga0181553_10293639All Organisms → Viruses → environmental samples → uncultured Mediterranean phage907Open in IMG/M
3300020175|Ga0206124_10053229All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300020266|Ga0211519_1052335Not Available794Open in IMG/M
3300020422|Ga0211702_10094163Not Available845Open in IMG/M
3300021365|Ga0206123_10065879All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300021959|Ga0222716_10091983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P2064Open in IMG/M
3300021960|Ga0222715_10648240Not Available538Open in IMG/M
3300022053|Ga0212030_1010185Not Available1158Open in IMG/M
3300022068|Ga0212021_1021912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1201Open in IMG/M
3300022068|Ga0212021_1101235Not Available591Open in IMG/M
3300022074|Ga0224906_1122973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P749Open in IMG/M
3300022925|Ga0255773_10375559All Organisms → Viruses → environmental samples → uncultured Mediterranean phage549Open in IMG/M
(restricted) 3300024052|Ga0255050_10073471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P759Open in IMG/M
3300025070|Ga0208667_1023369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P1175Open in IMG/M
3300025071|Ga0207896_1013854Not Available1427Open in IMG/M
3300025079|Ga0207890_1008072Not Available2295Open in IMG/M
3300025086|Ga0208157_1021386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1963Open in IMG/M
3300025086|Ga0208157_1065711All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P936Open in IMG/M
3300025098|Ga0208434_1101933Not Available560Open in IMG/M
3300025103|Ga0208013_1164716All Organisms → Viruses → environmental samples → uncultured Mediterranean phage521Open in IMG/M
3300025120|Ga0209535_1064717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1470Open in IMG/M
3300025120|Ga0209535_1079720All Organisms → Viruses → Predicted Viral1248Open in IMG/M
3300025120|Ga0209535_1147518Not Available748Open in IMG/M
3300025127|Ga0209348_1095675Not Available929Open in IMG/M
3300025128|Ga0208919_1176669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P650Open in IMG/M
3300025132|Ga0209232_1122867Not Available855Open in IMG/M
3300025133|Ga0208299_1180032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium641Open in IMG/M
3300025137|Ga0209336_10129247Not Available685Open in IMG/M
3300025137|Ga0209336_10159506Not Available590Open in IMG/M
3300025138|Ga0209634_1257367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P628Open in IMG/M
3300025264|Ga0208029_1107145Not Available500Open in IMG/M
3300025268|Ga0207894_1000084Not Available36356Open in IMG/M
3300025300|Ga0208181_1106536Not Available534Open in IMG/M
3300025645|Ga0208643_1045954Not Available1362Open in IMG/M
3300025652|Ga0208134_1018002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2711Open in IMG/M
3300025674|Ga0208162_1147401Not Available648Open in IMG/M
3300025722|Ga0209660_1258908Not Available530Open in IMG/M
3300025759|Ga0208899_1076932Not Available1314Open in IMG/M
3300025806|Ga0208545_1162359Not Available524Open in IMG/M
3300025897|Ga0209425_10576918Not Available502Open in IMG/M
3300028022|Ga0256382_1013136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P1637Open in IMG/M
3300028198|Ga0257121_1061101Not Available1501Open in IMG/M
3300029319|Ga0183748_1121650All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032277|Ga0316202_10313904Not Available730Open in IMG/M
3300032373|Ga0316204_11034914Not Available578Open in IMG/M
3300032820|Ga0310342_100980464Not Available990Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.53%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean9.71%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.71%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine6.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.91%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.91%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.94%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.94%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.97%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.97%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.97%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001740Marine viral communities from the Deep Pacific Ocean - MSP-114EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025264Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)EnvironmentalOpen in IMG/M
3300025268Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes)EnvironmentalOpen in IMG/M
3300025300Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028198Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005880233300000101MarineMNKVDIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLINKANEIS*
DelMOSum2010_1009397823300000101MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
DelMOSum2011_1009488223300000115MarineMNKVNIIASIVEGETLXDFGLLMEDTEFKXLLKAVINLPXEEATSQLINKANEIS*
DelMOSum2011_1012393533300000115MarineMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS*
DelMOSpr2010_1015519613300000116MarineNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS*
DelMOWin2010_1004505963300000117MarineMNKINIIASIVEGETLCDFGLLMEDTDFKNLLKSVINLPIEEATSQLINKANEIS*
DelMOWin2010_1017942633300000117MarineASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS*
JGI20158J14315_1016050323300001355Pelagic MarineMNKVNIIASIVEGETLCDFGLLMEXTDFKNLLKAVINLPLEEATSQLIXKANEIS*
JGI24003J15210_1014488733300001460MarineASIVEGETLCDFGLLMEDTDFKNLLKAVINLPIEEATSQLINKANEIS*
JGI24004J15324_1002811563300001472MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKTVINLPLEEATSQLINKANEIS*
JGI24004J15324_1013855113300001472MarineRKQMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQLINKANEIS*
JGI24004J15324_1014731823300001472MarineVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
JGI24005J15628_1003884913300001589MarineSIVEGETLCDFGLLMEDTEFKDLLKTVINLPLEEATSQLINKANEIS*
JGI24656J20076_1000093153300001740Deep OceanMNKLNIIASIVEGETLCNFNGLMEDLEFKKLLKAVINLPLEEATSQLINKANEIS*
JGI25127J35165_106786813300002482MarineMNKYNVIASWVEGETSCSWDCLMEDENFVKLLKAVINLPIEEATNQLIKKANEIS*
JGI25132J35274_106597723300002483MarineMTKYNMIASWVEGETLCAWDCLMEDEDFVRLLKAVINLPIEEATSQLIKKANEIS*
JGI26238J51125_104894523300003478MarineMNKINIIASIVEGETLCNFGLLMEDTDFKDLLKAVINLPIEEATSQLINKANKIS*
Ga0066223_121137213300004461MarineMNKINIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQLI
Ga0076924_110633923300005747MarineMNKVNIITSIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLINKANEIS*
Ga0075462_1006198233300006027AqueousMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPIEEATSQLINKANEIS*
Ga0098038_115072833300006735MarineMNKVNIIASIVEGKTLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEI
Ga0098037_103168063300006737MarineMNKVNIIASIVEGKTLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0098037_109092643300006737MarineMNKLNIIASIVEGETCCCFYSLMEDESFKKLVKKVINLPLEEATSQLINKANEIS*
Ga0098037_120170713300006737MarineMTKYNMIASWVEGETLCSWDCLMEDEDFVRLLKAVINLPIEEATSQLIKKANEIS*
Ga0098048_102262643300006752MarineMNKLNIIASIVEGETLCDFGLLMEDTEFKDLLKSVINLPIDEATSQLINKANEIS*
Ga0075467_1035907333300006803AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQLINKANEIS*
Ga0070754_1026335023300006810AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLINKANEIS*
Ga0070750_1032011423300006916AqueousMNKLNIIASIVEGKTLCDFGLLMEDTEFKDLLKAVINLPLEEATSQLINKANEIS*
Ga0070746_1008809143300006919AqueousMKKINIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0070746_1048376133300006919AqueousMNKVNIITSIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLI
Ga0098060_118799633300006921MarineASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0098045_113211513300006922MarineMNKLNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLI
Ga0075468_1011122153300007229AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQ
Ga0070747_132858633300007276AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATS
Ga0114899_113777013300008217Deep OceanMNKFNIIASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0114904_1004586173300008218Deep OceanASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0114905_104663453300008219Deep OceanMNKFNIIASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLIN
Ga0114910_105853553300008220Deep OceanHIDQKGGIMNKINIIASIVEGETLCNFSSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0114915_118346013300009428Deep OceanMNKVNIIASIVEGETLCDFGLLMEYTEFKDLLKAVINLPLEEATSQLINKANEIS*
Ga0114911_101243213300009603Deep OceanMNKLNIIASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0098043_106393733300010148MarineMNKLNMIASIVEGETCCCFYSLMEDEGFKELVKKVINLPLEEATSQLINKANEIS*
Ga0098056_101448273300010150MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPIEEATSQLINKANEIS*
Ga0114934_1012085133300011013Deep SubsurfaceMNKINIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPLEEATSQLINKANEIS*
Ga0160422_1053766823300012919SeawaterMNKYNMIASIVEGETLCDFNILMEDEDFIRLLKAVINLPIEEATHQLIKKANDIS*
Ga0160423_1046133833300012920Surface SeawaterMNKLNIIASIVEGETCCCFNSLMEDEGFKELVKKVINLPLEEATSQLINKANEIS*
Ga0163179_1047226033300012953SeawaterMNKINIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS*
Ga0181377_104822533300017706MarineMNKLNIIASIVEGETLCNFNCLMEDLEFKKLLKAVINLPLEEATSQLI
Ga0181369_110091113300017708MarineMNKLDIIASIVEGETCCCFYSLMEDESFKKLVKKVINLPLEEATPFS
Ga0181428_115517233300017738SeawaterMNKANVIASIVEGETLCNFNELMENTDFKNLFKDVVNLPIDKATDKLINKANEIS
Ga0181411_117748423300017755SeawaterMNKLNIIASIVEGETLCDFGLLMEDTEFKNLLKTVIDLPIDEATSQLINKANEIS
Ga0181420_108012423300017757SeawaterMNKVNIIASIVEGETLCNFSLLMENTEFKDLLKSVINLPLEEATSQLIKKANEIS
Ga0181420_110193813300017757SeawaterNQQKETMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEI
Ga0181385_103022053300017764SeawaterMNKINIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATMETK
Ga0187217_116314223300017770SeawaterMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQLINKANEIS
Ga0181386_102036743300017773SeawaterMNKVNIIASIVEGETFCDFGLLMEDTEFKNLLKAVINLPLEEATSQLIN
Ga0181432_109253913300017775SeawaterMNKVNIIASIVEGETFCNFGLLMEDTEFKKLLKAVINLPLEEATSQLINRANEIS
Ga0181423_135022413300017781SeawaterIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPIEQATSQLINKANEIS
Ga0181553_1029363923300018416Salt MarshMNKLNIIASIVEGETCCCFYSLMEDEGFKELVKKVINLPLEEATSQLINKANEIS
Ga0206124_1005322943300020175SeawaterMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLIKKANEIS
Ga0211519_105233533300020266MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0211702_1009416323300020422MarineMNKYNMIASIVEGETLCDFNILMEDEDFIRLLKAVINLPIEEATSQLIKKANEIS
Ga0206123_1006587923300021365SeawaterMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS
Ga0222716_1009198333300021959Estuarine WaterMNKLNIITSIVEGETLCDFNSLMEDTEFKKLLKAVINLPLEEATSQLINKANEIS
Ga0222715_1064824013300021960Estuarine WaterMNKINIIASIVEGETLCDFGLLMEDTDFKDLLKAVINLPIEEAT
Ga0212030_101018523300022053AqueousMNKINIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0212021_102191223300022068AqueousMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPIEEATSQLINKANEIS
Ga0212021_110123533300022068AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQL
Ga0224906_112297323300022074SeawaterMNKVNIIASIVEGETFCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0255773_1037555923300022925Salt MarshMVLYCILSITNRKVYMNKLNIIASIVEGETCCCFYSLMEDEGFKELVKKVINLPLEEATSQLINKANEIS
(restricted) Ga0255050_1007347123300024052SeawaterMNKLNIIASIVEGETLCNFNSLMEDLEFKKLLKAVINLPLEEATSQLINKANEIS
Ga0208667_102336943300025070MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKSVINLPIDEATSQLINKANEIS
Ga0207896_101385413300025071MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKTVINLPLEEATSQLINKANEIS
Ga0207890_100807223300025079MarineMKKVNIIASIVEGETLCDFGLLMEDTEFKDLLKTVINLPLEEATSQLINKANEIS
Ga0208157_102138643300025086MarineMNKVNIIASIVEGKTLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0208157_106571143300025086MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANE
Ga0208434_110193323300025098MarineMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPIEEATSQLINKANEIS
Ga0208013_116471613300025103MarineMNKLNIIASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0209535_106471723300025120MarineMNKINIIASIVEGETLCDFGLLMEDIEFKDLLKAVINLPLEEATSQLINKANEIS
Ga0209535_107972013300025120MarineKKTMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS
Ga0209535_114751833300025120MarineTMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPIEEATSQLINKANEIS
Ga0209348_109567513300025127MarineMNKYNVIASWVEGETSCSWDCLMEDENFVKLLKAVINLPIEEATNQLIKKANEIS
Ga0208919_117666923300025128MarineMTKYNMIASWVEGETLCSWDCLMEDEDFVRLLKAVINLPIEEATSQLIKKANEIS
Ga0209232_112286733300025132MarineMNKINIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPLEEATSQLINKANEIS
Ga0208299_118003223300025133MarineMNKVNIIASIVEGETLCNFGLLMEDTEFKKLLKAVINLPLEEATSQLINRANEIS
Ga0209336_1012924713300025137MarineIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPIEEATSQLINKANEIS
Ga0209336_1015950613300025137MarineERKQMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0209634_125736713300025138MarineMNKVNIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINK
Ga0208029_110714523300025264Deep OceanMNKFNIIASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0207894_1000084213300025268Deep OceanMNKLNIIASIVEGETLCNFNGLMEDLEFKKLLKAVINLPLEEATSQLINKANEIS
Ga0208181_110653613300025300Deep OceanASIVEGETLCNFGSLMEDTEFKNLLKAVINLPLEEATSQLINKANEIS
Ga0208643_104595413300025645AqueousMNKVNIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEQATSQLINK
Ga0208134_101800233300025652AqueousMNKVDIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLINKANEIS
Ga0208162_114740113300025674AqueousMNKINIIASIVEGETLCDFGLLMEDTDFKNLLKAVINLPLEEATSQLINKANEIS
Ga0209660_125890823300025722MarineMPNYRHIYLLTLINXKETMNKINIIASIVEGETLCDFGLLMEDTDFKDLLKAVINLPIEEATSQLINKANKIS
Ga0208899_107693213300025759AqueousMKKINIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKAN
Ga0208545_116235913300025806AqueousTNERKQMNKVDIIASIVEGETLCDFGLLMEDTEFKDLLKAVINLPIEKATSQLINKANEI
Ga0209425_1057691813300025897Pelagic MarineYLLTLINXKETMNKVNIIASIVEGETLCDFGLLMENTDFKNLLKAVINLPIEEATSQLINKANKIS
Ga0256382_101313643300028022SeawaterMSLDKMNKGDIIVSLVEGATTCSFYLLMEDTEFRNLLIAVIDLPLEEATSQLISKANEIS
Ga0257121_106110133300028198MarineMNKINIIASIVEGETLCNFGLLMEDTDFKDLLKAVINLPIEEATSQLINKANKIS
Ga0183748_112165013300029319MarineMNKYNMIASWVEGETLCSWDCLMEDEDFVKLLKAVINLPIKEATSQLIKKANEIS
Ga0316202_1031390423300032277Microbial MatMNKINIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPIEQATSQLINKANEIS
Ga0316204_1103491423300032373Microbial MatMNKVNIIASIVEGETLCDFGLLMEDTEFKNLLKAVINLPLEEATSQLINKA
Ga0310342_10098046423300032820SeawaterMSKLNIIASIVEGETLCNFNSLMENLEFKKLLKAVINLPLDEATSQLINKANEIS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.