NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099199

Metagenome Family F099199

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099199
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 102 residues
Representative Sequence HAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Number of Associated Samples 84
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.94 %
% of genes near scaffold ends (potentially truncated) 94.17 %
% of genes from short scaffolds (< 2000 bps) 97.09 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.029 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(23.301 % of family members)
Environment Ontology (ENVO) Unclassified
(90.291 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(97.087 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.35%    β-sheet: 0.00%    Coil/Unstructured: 55.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03237Terminase_6N 0.97
PF01555N6_N4_Mtase 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.97
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.97
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.03 %
UnclassifiedrootN/A0.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001460|JGI24003J15210_10134741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium654Open in IMG/M
3300001460|JGI24003J15210_10168776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium541Open in IMG/M
3300001472|JGI24004J15324_10160495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium510Open in IMG/M
3300002482|JGI25127J35165_1059386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium813Open in IMG/M
3300004460|Ga0066222_1060757All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300005057|Ga0068511_1012875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1135Open in IMG/M
3300005086|Ga0072334_10420209All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium926Open in IMG/M
3300006026|Ga0075478_10252174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HmicA12529Open in IMG/M
3300006637|Ga0075461_10253986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium515Open in IMG/M
3300006737|Ga0098037_1121002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium895Open in IMG/M
3300006789|Ga0098054_1348853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium525Open in IMG/M
3300006803|Ga0075467_10587696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium569Open in IMG/M
3300006870|Ga0075479_10124259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1062Open in IMG/M
3300006916|Ga0070750_10482634All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium509Open in IMG/M
3300006920|Ga0070748_1070147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1365Open in IMG/M
3300006928|Ga0098041_1103325All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300006928|Ga0098041_1243633All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium574Open in IMG/M
3300006929|Ga0098036_1177587All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium648Open in IMG/M
3300007229|Ga0075468_10204636All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium574Open in IMG/M
3300007236|Ga0075463_10134742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium798Open in IMG/M
3300007276|Ga0070747_1263014All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium597Open in IMG/M
3300007276|Ga0070747_1333060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium519Open in IMG/M
3300007344|Ga0070745_1361980All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium507Open in IMG/M
3300007345|Ga0070752_1030503All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2624Open in IMG/M
3300007346|Ga0070753_1228919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium680Open in IMG/M
3300007540|Ga0099847_1143957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium711Open in IMG/M
3300007542|Ga0099846_1291614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium560Open in IMG/M
3300007640|Ga0070751_1202560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium771Open in IMG/M
3300008216|Ga0114898_1158993All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium648Open in IMG/M
3300008218|Ga0114904_1154628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium537Open in IMG/M
3300008219|Ga0114905_1290069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium504Open in IMG/M
3300008220|Ga0114910_1109165All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium817Open in IMG/M
3300008220|Ga0114910_1195620All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium559Open in IMG/M
3300009071|Ga0115566_10672521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium575Open in IMG/M
3300009074|Ga0115549_1226263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
3300009412|Ga0114903_1059060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium885Open in IMG/M
3300009413|Ga0114902_1061776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1059Open in IMG/M
3300009413|Ga0114902_1130312All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium652Open in IMG/M
3300009414|Ga0114909_1137314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium651Open in IMG/M
3300009436|Ga0115008_10705363All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium733Open in IMG/M
3300009476|Ga0115555_1068704All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1560Open in IMG/M
3300009550|Ga0115013_11469362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium509Open in IMG/M
3300009603|Ga0114911_1104444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium824Open in IMG/M
3300009605|Ga0114906_1236723All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium600Open in IMG/M
3300010300|Ga0129351_1409858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium505Open in IMG/M
3300010368|Ga0129324_10179423All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium869Open in IMG/M
3300011252|Ga0151674_1016940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2421Open in IMG/M
3300011252|Ga0151674_1016941All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300012953|Ga0163179_10888059All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium770Open in IMG/M
3300013010|Ga0129327_10831611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300017697|Ga0180120_10061612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1675Open in IMG/M
3300017697|Ga0180120_10324741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium612Open in IMG/M
3300017706|Ga0181377_1074126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium614Open in IMG/M
3300017717|Ga0181404_1164146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium534Open in IMG/M
3300017720|Ga0181383_1092796All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium810Open in IMG/M
3300017720|Ga0181383_1136143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300017720|Ga0181383_1217256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium506Open in IMG/M
3300017724|Ga0181388_1150693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium552Open in IMG/M
3300017733|Ga0181426_1085069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium633Open in IMG/M
3300017738|Ga0181428_1032366All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1214Open in IMG/M
3300017738|Ga0181428_1114592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium632Open in IMG/M
3300017739|Ga0181433_1039196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1220Open in IMG/M
3300017741|Ga0181421_1065668All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium955Open in IMG/M
3300017746|Ga0181389_1143851All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium637Open in IMG/M
3300017748|Ga0181393_1103856All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium730Open in IMG/M
3300017748|Ga0181393_1190350All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium500Open in IMG/M
3300017756|Ga0181382_1156853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium590Open in IMG/M
3300017757|Ga0181420_1251870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium501Open in IMG/M
3300017758|Ga0181409_1240339All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium515Open in IMG/M
3300017760|Ga0181408_1079252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium861Open in IMG/M
3300017763|Ga0181410_1227827All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium505Open in IMG/M
3300017764|Ga0181385_1104969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium865Open in IMG/M
3300017767|Ga0181406_1228828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium548Open in IMG/M
3300017767|Ga0181406_1235299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium539Open in IMG/M
3300017771|Ga0181425_1268491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300017781|Ga0181423_1308263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium582Open in IMG/M
3300017786|Ga0181424_10157638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium971Open in IMG/M
3300020410|Ga0211699_10298452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium628Open in IMG/M
3300020424|Ga0211620_10181850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium901Open in IMG/M
3300021185|Ga0206682_10324305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium666Open in IMG/M
3300022929|Ga0255752_10325341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium639Open in IMG/M
3300025120|Ga0209535_1077133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1281Open in IMG/M
3300025120|Ga0209535_1087506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1157Open in IMG/M
3300025120|Ga0209535_1168753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium662Open in IMG/M
3300025120|Ga0209535_1184127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium611Open in IMG/M
3300025120|Ga0209535_1202071All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium557Open in IMG/M
3300025138|Ga0209634_1231032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium683Open in IMG/M
3300025138|Ga0209634_1310031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium538Open in IMG/M
3300025270|Ga0208813_1097676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium589Open in IMG/M
3300025301|Ga0208450_1066064All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium851Open in IMG/M
3300025305|Ga0208684_1142813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium566Open in IMG/M
3300025508|Ga0208148_1097798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
3300025769|Ga0208767_1159744All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium808Open in IMG/M
3300025828|Ga0208547_1153269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium656Open in IMG/M
3300025853|Ga0208645_1255698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium579Open in IMG/M
3300027833|Ga0209092_10165749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1265Open in IMG/M
3300029309|Ga0183683_1018633All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1472Open in IMG/M
3300029787|Ga0183757_1028757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1197Open in IMG/M
3300029787|Ga0183757_1057337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium640Open in IMG/M
3300031519|Ga0307488_10660111All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium597Open in IMG/M
3300034374|Ga0348335_174999All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium553Open in IMG/M
3300034418|Ga0348337_052243All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1631Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater23.30%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.42%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean13.59%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.85%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.94%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.97%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.97%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.97%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025270Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes)EnvironmentalOpen in IMG/M
3300025301Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24003J15210_1013474123300001460MarineEVRNAILGLLKDGVPKLHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTSAG*
JGI24003J15210_1016877623300001460MarineAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG*
JGI24004J15324_1016049513300001472MarineGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKSTFGSDAGKGGGLAVQINIMRDGEPEVVDVTNVTTP*
JGI25127J35165_105938623300002482MarineMLNEGVPKVHAARAAGVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERTQKAEFGSDSQRGGGVAVQINIERGGDTEVIDVTPSS*
Ga0066222_106075713300004460MarineQPSQSVLARDDKQATVLALLKDGVPKTHAAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRGTFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG*
Ga0068511_101287513300005057Marine WaterGVHETTLHRWISECENFASEVRAAESAAVALRVRRIGQAGERDWRADSWFLERTQRDSFGSDSSKGGAVNVQINIERGGSETVLRQADIVD*
Ga0072334_1042020923300005086WaterLGLLKDGVPKIHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPSG*
Ga0075478_1025217413300006026AqueousSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPSG*
Ga0075461_1025398613300006637AqueousDGVPRKHAAQSVGIGESTLLRWINEDDGFGAEVRAAESAAVALRVRRIGQAGERDWRADSWYLERTQRDSFGSDSSKGGAVNVQINIERDTKGTEPVRIESID*
Ga0098037_112100223300006737MarineLRDGVPRKHAAQGAGVSESTLLRWINDDEGFGAEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0098054_134885313300006789MarineDGVPKTHAAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGNGLAVQINIMRDGEPEVVDVTPAG*
Ga0075467_1058769613300006803AqueousKDGVPKTHAAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGERDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ*
Ga0075479_1012425923300006870AqueousLLKDGVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ*
Ga0070750_1048263423300006916AqueousAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0070748_107014733300006920AqueousASGVSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQRATFGSDSGKGGGVAVQINIVRGDEPEVIDVTPGS*
Ga0098041_110332523300006928MarineDKRGVILEMLNEGVPKVHAARAAGVHENTLTRWLNEDAEFSDAVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0098041_124363323300006928MarineHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGADAGKGGGLAVQINIMRDGEPEVVDVTPAG*
Ga0098036_117758723300006929MarineGVPKTHAAAVAGVSEATLHRWVNDDESFKSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGADAGKGGGLAVQINIMRDGEPEVVDVTPAG*
Ga0075468_1020463613300007229AqueousMLRDDKRRAIVEMLGEGVPKVHAAAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0075463_1013474213300007236AqueousRRAIVEMLGEGVPKVHAAAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0070747_126301413300007276AqueousASGVSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQKATFGSDSGKGGGVAVQINIVRGDEPEVIDVTPGS*
Ga0070747_133306013300007276AqueousRNAILGLLKDGVPKLHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG*
Ga0070745_136198013300007344AqueousDKRAAIIELLGDGVPKVHAAAVAGVSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAE*
Ga0070752_103050333300007345AqueousKLFVHAAAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0070753_122891923300007346AqueousKQATVLALLKDGVPKTHAAAVAGVSEATLHRWVNDDDKFKSEVRQAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG*
Ga0099847_114395723300007540AqueousNIDTLSRWMNDDQEFGIEVRAQERRAVADRVQRIGAAGKRGDWKADSWYLERTQREIFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAR*
Ga0099846_129161413300007542AqueousMLRDDKRRAIVEMLGEGVPKVHAAAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPSG*
Ga0070751_116926323300007640AqueousEFAIEVRAQERRAVADRVQRIGAAGKRGDWKADSWYLERTQREIFGSDAGKSGGLAVQINIMRDGDPEVIDVTPSG*
Ga0070751_120256023300007640AqueousPEVRNAIIGLLRDGVPKTHAAQASGVSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQKATFGSDSGKGGGVAVQINIVRGDEPEVIDVTPGS*
Ga0114898_115899323300008216Deep OceanLEMLNEGVPKVHAARVAGVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERAHRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0114904_115462813300008218Deep OceanKIHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKSGGLAVQINIMRDGDPEVIDVTPAG*
Ga0114905_129006913300008219Deep OceanVAGAQPKAALIDKNDKRGVILEMLNEGVPKVHAARAAGVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS*
Ga0114910_110916513300008220Deep OceanDTPEVRNAILGLLKDGVPKIHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAG*
Ga0114910_119562013300008220Deep OceanVAGAQPKAALIDKNDKRGVILEMLNEGVPKVHAARAAGVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERAHRAEFGSDSQRGGGVAVQINIERGGDTEVIDVTPGS*
Ga0115566_1067252113300009071Pelagic MarineVLVRDDKKDAVLALLKDGVPKIHAAQAVGVHENTLARWLQEDSEFDVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG*
Ga0115549_122626313300009074Pelagic MarineGVSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGNESITNL*
Ga0114903_105906023300009412Deep OceanLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRATFGSDAGKGGGVAVQINIVRSDEPEVVNVTPGS*
Ga0114902_106177623300009413Deep OceanLKDGVPKKHAAQVVGVHEATLHRWIADDAAFASEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQRGGGVAVQINIERGGDTEVIDVTPGS*
Ga0114902_113031223300009413Deep OceanIELLKDGVPKTHAAQASGVSVDAFNAWVSRDADFAALVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQRATFGSDAGKGGGVAVQINIVRGDEPEVVNVTPSS*
Ga0114909_113731413300009414Deep OceanVVREDKRAAIIELLGDGVPKVHAAAVAGVSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPSG*
Ga0115008_1070536313300009436MarineVLVRDDKKDAVLALLKDGVPKIHAAQAVGVHENTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG*
Ga0115555_106870423300009476Pelagic MarineEAVLALLKDGVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG*
Ga0115013_1146936223300009550MarineDKQGVVLEMLREGVPKVHAARAAGVHENTLQRWLNENAEFGDAVRAAESAAVLHRLRRIEGHGKRDWRADSWFLERTQRDTFGSDAGKGGGVAVQINIQRNVSDATEAVVIDGKS*
Ga0114911_110444423300009603Deep OceanSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ*
Ga0114906_123672313300009605Deep OceanVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERAHRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGN*
Ga0129351_140985813300010300Freshwater To Marine Saline GradientPEVRNAIIGLLRDGVPKTHAAQASGVSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQRATFGSDSGKGGGVAVQINIVRGDEPEVVDVTPGS*
Ga0129324_1017942323300010368Freshwater To Marine Saline GradientGVSEATLHRWVNDDDKFKSEVRQAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGGGLAVQINIMRGDDAEVIDVTPAG*
Ga0151674_101694023300011252MarineHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ*
Ga0151674_101694113300011252MarineVHAAQAVGVHENTLTRWIKEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ*
Ga0163179_1088805913300012953SeawaterKDGVPKKHAAHVVGVHEATLHRWIADDAAFASEVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERTQRATFGSDAGKGGGVAVQINIVRSDEPEVVNVTPGS*
Ga0129327_1083161113300013010Freshwater To Marine Saline GradientESTLRRWIANDERFSSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRAAFGSDSGKGGGVAVQINIVRGDEPEVIDVTPSS*
Ga0180120_1006161213300017697Freshwater To Marine Saline GradientIHAAQAVGVHENTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGGGLAVQINIMRGDDAEVIDVTPAG
Ga0180120_1032474113300017697Freshwater To Marine Saline GradientLGLLKDGVPKLHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ
Ga0181377_107412613300017706MarineALLKDGVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVYVTPAG
Ga0181404_116414613300017717SeawaterVSEATLHRWVNEDEKFKSEVRAAEGAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181383_109279623300017720SeawaterLHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDITPAG
Ga0181383_113614323300017720SeawaterSAAVMARDDKQGAALELLRDGVPRKHAAQGVGVSESTLLRWINDDEGFGSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPG
Ga0181383_121725613300017720SeawaterLHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGRAGEKDWRADSWYLERTQKATFGADSGKGGGLAVQINIMRDGEPEVVDVTPGQ
Ga0181388_115069313300017724SeawaterGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181426_108506923300017733SeawaterVHENTLTRWLNEDAEFSAAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181428_103236633300017738SeawaterIELLGDGVPKIHAAAVAGVSDATLHRWINEDDNFKRKVRAAESAAVALRVQRIGQAGKKDWRADSWYLERTQRATFGSDAGKGGGVAVQINIVRSDEPGVVNVTPGS
Ga0181428_111459213300017738SeawaterLLRWINDDEGFGAEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181433_103919633300017739SeawaterAAAVAGVSDATLHRWINEDDNFKRKVRAAESAAVALRVQRIGQAGKKDWRADSWYLERTQKATFGSDAGKGGGVAVQINIVRSDEPEVVNVTPGS
Ga0181421_106566813300017741SeawaterQGAGVSESTLLRWINDDEGFGSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181389_114385113300017746SeawaterSDTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0181393_110385613300017748SeawaterAVAGVSDATLHRWINEDDNFKRKVRAAESAAVALRVQRIGQAGKKDWRADSWYLERTQKATFGSDAGKGGGVAVQINIVRSDEPEVVNVTPGS
Ga0181393_119035013300017748SeawaterINDDQEFGIEVRAQERRAVADRVQRIGAAGKRGDWKADSWYLERTQREIFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAG
Ga0181382_115685313300017756SeawaterNIDTLTRWINDDQEFGIEVRAQERRAVADRVQRIGAAGKRGDWKADSWYLERTQREIFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAG
Ga0181420_125187013300017757SeawaterLEMLNEGVPKVHAAAIAGVSEATLHRWVNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181409_124033913300017758SeawaterTPEVRNAILGLLKGGVPKIHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDQEVIDVTPAG
Ga0181408_107925213300017760SeawaterLHRWLNEDEKFKSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181410_122782713300017763SeawaterIALLKDGVPKIHAAQAVGVHENTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0181385_110496913300017764SeawaterECSGVNIDTLTRWINDDQEFGIEVRAQERRAVADRVQRIGAAGKRGDWKADSWYLERTQREIFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAG
Ga0181406_122882813300017767SeawaterQPVAVAEPSAAVMARDDKQGAALELLRDGVPRKHAAQGAGVSESTLLRWINDDEGFGAEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0181406_123529913300017767SeawaterHENTLTRWLNEDAEFGGAVRAAESAAVALRVQRIGRAGEKDWRADSWYLERTQKATFGSDSGKGGGLAVQINIMRDGEPEVVDVTPGQ
Ga0181425_126849113300017771SeawaterVHAAAVAGVSEATLHRWVNEDDQFKRDLRAAESAAVALRVQRIGRAGEKDWRADSWYLERTQKATFGADSGKGGGLAVQINIMRDGEPEVVDVTPGQ
Ga0181423_130826313300017781SeawaterEDKRAAIIELLGDGVPKIHAAAVEGVSDATLHRWINEDDNFKRKVRAAESAAVALRVQRIGKAGQKDWRADSWYLERTQKATFGSDAGKGGGVAVQINIVRGDEPEVVNVTPGS
Ga0181424_1015763813300017786SeawaterHAAQGAGVSESTLLRWINDDEGFGSEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0211699_1029845213300020410MarineKHAAQVVGVHEATLHRWIADDAAFASEVRAAESAAVALRVRRIGQAGERDWRADSWFLERTQRDSFGSDSSKGGAVNVQINIERNSADATAGVVIEGES
Ga0211620_1018185023300020424MarineGAALELLRDGVPRKHAAQIVGIGESTLLRWINDDEVFGAEVRAAESAAVALRVRRIGRAGERDWRADSWFLERTQRDSFGSDNSKGGAVNVQINIERNSADATAGVVIEGES
Ga0206682_1032430523300021185SeawaterKSSSSVLVRDDKKDAVLALLKDGVPKIHAAQAVGVHENTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0255752_1032534123300022929Salt MarshDGVPRKHAAQSVGIGESTLLRWINEDDGFGAEVRAAESAAVALRVRRIGQAGERDWRADSWYLERTQRDSFGSDNAKSGAVNVQINIERGGSETVLRQADIVD
Ga0209535_107713313300025120MarineKRAAIVQLLSEGVPKVHAAAVAGVSEATLHRWVNEDDQFKRDLRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPTG
Ga0209535_108750623300025120MarineATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Ga0209535_116875323300025120MarineKQATVLALLKDGVPKTHAAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRGTFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Ga0209535_118412723300025120MarineKTHAAAVAGVSEATLHRWVNDDESFRSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKSTFGSDAGKGGGLAVQINIMRDGEPEVVDVTNVTTP
Ga0209535_120207113300025120MarineESTLRRWIANDERFSSEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQRAAFGSDSGKGGGVAVQINIVRGDEPEVIDVTPSS
Ga0209634_123103223300025138MarineDGVPKVHAAAVAGVSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGDPEVIDVTPAG
Ga0209634_131003113300025138MarineHAAQAVGVHENTLNRWLNDDSGFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Ga0208813_109767613300025270Deep OceanAGAQPKAALIDRNDKRGVILEMLNEGVPKVHAARAAGVHENTLTRWLNEDAEFSDAVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERAHRAEFGSDSQRGGGVAVQINIERGGDTEVIDVTPGS
Ga0208450_106606413300025301Deep OceanVAGVSEATLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKSGGLAVQINIMRDGDPEVIDVTPAG
Ga0208684_114281313300025305Deep OceanAALELLRDGVPRKHAAQGVGVSESTLLRWINDDEGFGAEVRAAESAAVAFRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPGS
Ga0208148_109779813300025508AqueousKREAVLALLKDGVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Ga0208767_115974423300025769AqueousQASGVSLDAFNAWVSRDADFAGLVRAAESAAVSLRVQRIGKAGQKDWRADSWYLERTQKATFGSDSGKGGGVAVQINIVRGDEPEVIDVTPGS
Ga0208547_115326913300025828AqueousLKDGVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPGQ
Ga0208645_125569813300025853AqueousQPQPSQAVLARDDKQATVLALLKDGVPKTHAAAVAGVSEATLHRWVNDDDKFKSEVRQAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0209092_1016574913300027833MarineAGVSEATLHRWVNDDDKFKSEVRQAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0183683_101863333300029309MarineLLRDGVPRKHAAQGVGVSESTLLRWINDDEGFGAEVRAAESAAVALRVRRIGKAGEKDWRADSWYLERTQRAEFGSDSQKGGGVAVQINIERGGDTEVIDVTPSS
Ga0183757_102875713300029787MarineTLHRWISEDDKFKSEIRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDADPEVIDVTPSG
Ga0183757_105733723300029787MarineAVLDLLADGVPKIHAAQAVGVHENTLTRWLNDDAEFGGKVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGNGLAVQINIMRDGARGC
Ga0307488_1066011113300031519Sackhole BrineVPKVHAAQAVGVHENTLTRWIQEDSEFSAEVRAAESAAVALRVQRIGKAGEKDWRADSWYLERTQKATFGSDAGKGGGLAVQINIMRDGEPEVVDVTPAG
Ga0348335_174999_2_2653300034374AqueousEATLHRWVNDDDKFKSEVRQAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG
Ga0348337_052243_4_3063300034418AqueousVPKIHAAQAVGVHENTLARWLQEDSEFGVEVRSAESEAVALRVQRIGKAGEKDWRADSWYLERTQKATFGAEAGKGSGVAVQINIMRGDDAEVIDVTPAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.