Basic Information | |
---|---|
Family ID | F099259 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 46 residues |
Representative Sequence | VSESTQDRPDEADEKAPKPGEQDTETVAGVPKKAPESTDGEQSKQDQ |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 66.67 % |
% of genes near scaffold ends (potentially truncated) | 46.60 % |
% of genes from short scaffolds (< 2000 bps) | 87.38 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.340 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.417 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.981 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.223 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.33% β-sheet: 5.33% Coil/Unstructured: 89.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF01872 | RibD_C | 4.85 |
PF08031 | BBE | 3.88 |
PF12697 | Abhydrolase_6 | 2.91 |
PF01427 | Peptidase_M15 | 1.94 |
PF00561 | Abhydrolase_1 | 1.94 |
PF13185 | GAF_2 | 0.97 |
PF05532 | CsbD | 0.97 |
PF00196 | GerE | 0.97 |
PF05368 | NmrA | 0.97 |
PF00583 | Acetyltransf_1 | 0.97 |
PF13376 | OmdA | 0.97 |
PF13412 | HTH_24 | 0.97 |
PF02775 | TPP_enzyme_C | 0.97 |
PF08922 | DUF1905 | 0.97 |
PF08668 | HDOD | 0.97 |
PF00528 | BPD_transp_1 | 0.97 |
PF02449 | Glyco_hydro_42 | 0.97 |
PF00239 | Resolvase | 0.97 |
PF01261 | AP_endonuc_2 | 0.97 |
PF04679 | DNA_ligase_A_C | 0.97 |
PF02082 | Rrf2 | 0.97 |
PF08241 | Methyltransf_11 | 0.97 |
PF01391 | Collagen | 0.97 |
PF13669 | Glyoxalase_4 | 0.97 |
PF07366 | SnoaL | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 4.85 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 4.85 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 3.88 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.97 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.97 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.97 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.97 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.97 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.97 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.97 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.97 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.97 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.97 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.97 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.97 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.34 % |
All Organisms | root | All Organisms | 44.66 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_107207360 | Not Available | 980 | Open in IMG/M |
3300002568|C688J35102_119719874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300002568|C688J35102_120853247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1829 | Open in IMG/M |
3300004153|Ga0063455_100623814 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300004153|Ga0063455_100628272 | Not Available | 706 | Open in IMG/M |
3300004156|Ga0062589_101397483 | Not Available | 682 | Open in IMG/M |
3300004463|Ga0063356_106078413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 517 | Open in IMG/M |
3300004643|Ga0062591_100892332 | Not Available | 832 | Open in IMG/M |
3300004803|Ga0058862_12152876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300005093|Ga0062594_102402217 | Not Available | 576 | Open in IMG/M |
3300005334|Ga0068869_101664696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300005345|Ga0070692_10106355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1546 | Open in IMG/M |
3300005355|Ga0070671_101444678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300005364|Ga0070673_101291951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
3300005367|Ga0070667_101646402 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005438|Ga0070701_10693007 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300005441|Ga0070700_101793310 | Not Available | 528 | Open in IMG/M |
3300005466|Ga0070685_10068908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2091 | Open in IMG/M |
3300005544|Ga0070686_100310722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1172 | Open in IMG/M |
3300005544|Ga0070686_100711002 | Not Available | 802 | Open in IMG/M |
3300005547|Ga0070693_101633367 | Not Available | 507 | Open in IMG/M |
3300005564|Ga0070664_101469917 | Not Available | 645 | Open in IMG/M |
3300005578|Ga0068854_100142829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1839 | Open in IMG/M |
3300005718|Ga0068866_11193828 | Not Available | 549 | Open in IMG/M |
3300005718|Ga0068866_11269263 | Not Available | 534 | Open in IMG/M |
3300005719|Ga0068861_101806899 | Not Available | 606 | Open in IMG/M |
3300005764|Ga0066903_104544614 | Not Available | 740 | Open in IMG/M |
3300006574|Ga0074056_11808008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
3300006847|Ga0075431_100198927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2051 | Open in IMG/M |
3300006880|Ga0075429_100793921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 829 | Open in IMG/M |
3300009094|Ga0111539_10172948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2523 | Open in IMG/M |
3300009094|Ga0111539_13213091 | Not Available | 527 | Open in IMG/M |
3300009100|Ga0075418_12827066 | Not Available | 530 | Open in IMG/M |
3300009162|Ga0075423_13125448 | Not Available | 507 | Open in IMG/M |
3300009553|Ga0105249_11724558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
3300009553|Ga0105249_12320700 | Not Available | 609 | Open in IMG/M |
3300009789|Ga0126307_11355048 | Not Available | 576 | Open in IMG/M |
3300010036|Ga0126305_10630202 | Not Available | 722 | Open in IMG/M |
3300010037|Ga0126304_11246607 | Not Available | 510 | Open in IMG/M |
3300010400|Ga0134122_12868579 | Not Available | 535 | Open in IMG/M |
3300010403|Ga0134123_13312984 | Not Available | 520 | Open in IMG/M |
3300010878|Ga0136899_10466571 | Not Available | 520 | Open in IMG/M |
3300012212|Ga0150985_100482992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
3300012212|Ga0150985_100684005 | Not Available | 749 | Open in IMG/M |
3300012212|Ga0150985_104319863 | Not Available | 526 | Open in IMG/M |
3300012212|Ga0150985_104596696 | Not Available | 786 | Open in IMG/M |
3300012212|Ga0150985_112130492 | Not Available | 551 | Open in IMG/M |
3300012212|Ga0150985_112224049 | Not Available | 827 | Open in IMG/M |
3300012212|Ga0150985_113750984 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012469|Ga0150984_105365649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Arboricoccus → Arboricoccus pini | 2750 | Open in IMG/M |
3300012469|Ga0150984_106379738 | Not Available | 527 | Open in IMG/M |
3300012469|Ga0150984_111577025 | Not Available | 552 | Open in IMG/M |
3300012469|Ga0150984_115172846 | Not Available | 544 | Open in IMG/M |
3300012469|Ga0150984_117268882 | Not Available | 751 | Open in IMG/M |
3300012469|Ga0150984_117466821 | Not Available | 535 | Open in IMG/M |
3300012469|Ga0150984_118360985 | Not Available | 502 | Open in IMG/M |
3300012684|Ga0136614_10712038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300014487|Ga0182000_10265474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
3300014745|Ga0157377_10070085 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300015371|Ga0132258_13289906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
3300017789|Ga0136617_10998410 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300018422|Ga0190265_11885800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300018469|Ga0190270_12778950 | Not Available | 552 | Open in IMG/M |
3300018476|Ga0190274_10975304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 920 | Open in IMG/M |
3300018476|Ga0190274_12218203 | Not Available | 646 | Open in IMG/M |
3300019377|Ga0190264_10036533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1846 | Open in IMG/M |
3300024430|Ga0196962_10088897 | Not Available | 952 | Open in IMG/M |
3300024430|Ga0196962_10102714 | Not Available | 888 | Open in IMG/M |
3300025899|Ga0207642_10290003 | Not Available | 945 | Open in IMG/M |
3300025901|Ga0207688_10038708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2647 | Open in IMG/M |
3300025908|Ga0207643_10806666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300025918|Ga0207662_11323561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinopolysporales → Actinopolysporaceae → Actinopolyspora → Actinopolyspora mzabensis | 512 | Open in IMG/M |
3300025931|Ga0207644_11222092 | Not Available | 632 | Open in IMG/M |
3300025944|Ga0207661_11470508 | Not Available | 625 | Open in IMG/M |
3300025961|Ga0207712_11206401 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300025981|Ga0207640_11795286 | Not Available | 554 | Open in IMG/M |
3300026075|Ga0207708_11853645 | Not Available | 529 | Open in IMG/M |
3300027907|Ga0207428_10246548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1333 | Open in IMG/M |
3300028704|Ga0307321_1059147 | Not Available | 736 | Open in IMG/M |
3300028705|Ga0307276_10071955 | Not Available | 800 | Open in IMG/M |
3300028710|Ga0307322_10032138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1245 | Open in IMG/M |
3300028715|Ga0307313_10045550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1276 | Open in IMG/M |
3300028755|Ga0307316_10408658 | Not Available | 503 | Open in IMG/M |
3300028810|Ga0307294_10323795 | Not Available | 564 | Open in IMG/M |
3300028872|Ga0307314_10158205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
3300028881|Ga0307277_10164169 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300028881|Ga0307277_10588063 | Not Available | 500 | Open in IMG/M |
3300030830|Ga0308205_1048800 | Not Available | 560 | Open in IMG/M |
3300030903|Ga0308206_1136082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300031058|Ga0308189_10252956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 666 | Open in IMG/M |
3300031091|Ga0308201_10102327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 829 | Open in IMG/M |
3300031229|Ga0299913_10632389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
3300031548|Ga0307408_101851412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
3300031901|Ga0307406_10117613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1842 | Open in IMG/M |
3300032013|Ga0310906_11402302 | Not Available | 513 | Open in IMG/M |
3300032075|Ga0310890_10636691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.42% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 7.77% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 7.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.88% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.91% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010878 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1072073602 | 3300000956 | Soil | DRLDEAHGQAPKPGEPDTETAAGQPRKVPESKDDGQESK* |
C688J35102_1197198741 | 3300002568 | Soil | VSESTQDRPDEADEKAPKPGEQDTETVAGVPKKAPESTDGEQSKQDQ* |
C688J35102_1208532472 | 3300002568 | Soil | VSESTQDRPNEADENAPKPGEQDTETVAGQPKKAPASKDGEQSKQDE* |
Ga0063455_1006238142 | 3300004153 | Soil | VSESTQDRPNESDEKAPTPGEEGTETVAGNPKKAPESKDGEQ |
Ga0063455_1006282722 | 3300004153 | Soil | VSESTQDRPNEPDEKAPTPGESGTETVAGNPKKAPESKDGEQ |
Ga0062589_1013974831 | 3300004156 | Soil | MSEPVQDQANQADETAPKPGEQDTETEAGMPKKAPDSKDGEQSKQDQ* |
Ga0063356_1060784132 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQDRSDKADEKAPKPGEQDTDTVAGVPKEAPKSKDGEQSKQDQ* |
Ga0062591_1008923321 | 3300004643 | Soil | DRPDEVDEKAPKPGEQDTETVAGMPTKPPESKEGEQSKQDE* |
Ga0058862_121528762 | 3300004803 | Host-Associated | QGDRVSESTQDRPAEADEKAPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0062594_1024022171 | 3300005093 | Soil | VSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0068869_1016646961 | 3300005334 | Miscanthus Rhizosphere | VSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDSGEQSKQDE* |
Ga0070692_101063551 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PAHRNQGDRVSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0070671_1014446781 | 3300005355 | Switchgrass Rhizosphere | VSESTQDRPAEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0070673_1012919512 | 3300005364 | Switchgrass Rhizosphere | PATKEIAVSESTHDQPDNADEKAPKPGEQDTETVAGQPKKAPASKEQSKQDQ* |
Ga0070667_1016464022 | 3300005367 | Switchgrass Rhizosphere | DRVSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0070701_106930072 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TKEIAVSESTHDQPDNADEKAPKPGEQDTETVAGQPKKAPASKQQSKQDQEAG* |
Ga0070700_1017933101 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESTQTRPPEADEKVAKPGEPDTETVAGQPKKAPDSKDGKQSKQDQK* |
Ga0070685_100689084 | 3300005466 | Switchgrass Rhizosphere | GPATEEVAMTESTQTRPPEADEKVAKPGEADTETVAGRPKKAPDSKDGKQSKQDQS* |
Ga0070686_1003107222 | 3300005544 | Switchgrass Rhizosphere | VSESTQGRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0070686_1007110021 | 3300005544 | Switchgrass Rhizosphere | MSESTQDRPDQANENAPKPGEDDTETVAGQPRKAPDSKDGEQSKQDE* |
Ga0070693_1016333672 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TEEIAVSESTQDRPDKADEQAPKPGEQDTETVAGNPKKAPASKQQSKQDE* |
Ga0070664_1014699172 | 3300005564 | Corn Rhizosphere | VSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDG |
Ga0068854_1001428294 | 3300005578 | Corn Rhizosphere | VSESTQDRPAEADEKAPKPGEQGTETVAGAPKKAPASDGGEQSKQDE* |
Ga0068866_111938281 | 3300005718 | Miscanthus Rhizosphere | VPATKEIAVSESTQDRPDKADENAPKPGEQDTETVAGQPKKAPASKEQSKQDQ* |
Ga0068866_112692631 | 3300005718 | Miscanthus Rhizosphere | YTAKEIAVSEAQQVRSDKADEKAPKPGEQDTETVAGVPRKAPESKDGEQSKQDQ* |
Ga0068861_1018068992 | 3300005719 | Switchgrass Rhizosphere | MSESTQDRPDQANENAPKPGEDDTETVAGQPRKAPDSKDGEQSK |
Ga0066903_1045446142 | 3300005764 | Tropical Forest Soil | MTESPQDRPDEADEKTQEKPGEPDTDTMGGFPEKAPDSKDGEAPSKPNQ* |
Ga0074056_118080081 | 3300006574 | Soil | MSETAQDRPDEADENAPKPGEQDTETMAGRPRNAPESKDGEQ |
Ga0075431_1001989272 | 3300006847 | Populus Rhizosphere | VSESTKDRPNEVDENAPKPGEKDTKTVAGQPLKAPDHKQGEQSKQDE* |
Ga0075429_1007939211 | 3300006880 | Populus Rhizosphere | AVSESTKDRPNEVDEKAPKPGEQDTKTVAGQPLKAPDHKDGEQSKQDE* |
Ga0105240_121428471 | 3300009093 | Corn Rhizosphere | EKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0111539_101729483 | 3300009094 | Populus Rhizosphere | VSESTKDRPNEVDEDAPKPGEKDTKTVAGQPLKAPDHKQGEQSKQDE* |
Ga0111539_132130912 | 3300009094 | Populus Rhizosphere | MSESTQDRPDEADAKAPKPGEPDTETVAGQPRKAPESKDGEQQSKQDQ* |
Ga0075418_128270661 | 3300009100 | Populus Rhizosphere | DKADEKAAKPGEQDTETVAGVPKKAPDSKDQPSKQDE* |
Ga0075423_131254482 | 3300009162 | Populus Rhizosphere | VSATKEIAMSESTQDRPDEGDEQTQKPGEPDTETVAGRPRKAPESTDGEQS |
Ga0105238_114187131 | 3300009551 | Corn Rhizosphere | TEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE* |
Ga0105249_117245582 | 3300009553 | Switchgrass Rhizosphere | VSESTQSRPQEVDEKAPKPGEKDTETVAGQPLKAPAHKDGEQSKQDEE* |
Ga0105249_123207002 | 3300009553 | Switchgrass Rhizosphere | LYTAKEIAVSEAPQVRSDKADEKAPKPGEQDTETVAGVPRKAPESKDGE |
Ga0126307_113550481 | 3300009789 | Serpentine Soil | VSESTQDRPDQPDEADENAPKPGEQDTDTVAGVPKQAPESKEG |
Ga0126305_106302022 | 3300010036 | Serpentine Soil | VSESTQDRPDEADEKATKPGEQDTETVAGVPKKAPESKDGEQSKQD |
Ga0126304_112466071 | 3300010037 | Serpentine Soil | VSESTQDRPDEADEKATKPGEQDTETVAGVPKQAPESKDGEQSKQ |
Ga0134122_128685792 | 3300010400 | Terrestrial Soil | MSESTQDRPDQANENAPKPGEDDTETVAGQPRKAPDSKD |
Ga0134123_133129841 | 3300010403 | Terrestrial Soil | MSESTQDRPDQANESAPKPGEDDTETVAGQPRKAPDSKDGEQSKQDE* |
Ga0136899_104665711 | 3300010878 | Soil | QDRPDEVDENAPKPGEPDTETVAGQPRKAPESKDGEEQTKQDQ* |
Ga0150985_1004829921 | 3300012212 | Avena Fatua Rhizosphere | MSESTQDRPDEAGENAPKPGEQDTETVAGVPKKAPDSKDGEQSKQDQ* |
Ga0150985_1006840051 | 3300012212 | Avena Fatua Rhizosphere | VSESTQDRPDEANEKAPKPGEQDTDTVAGVPKKAPESKDGEQSKQDQ* |
Ga0150985_1043198631 | 3300012212 | Avena Fatua Rhizosphere | MSESTQGQPAEADEKAQKPGQEDTETVAGVPKKAPDSKDGEQSKQDE* |
Ga0150985_1045966961 | 3300012212 | Avena Fatua Rhizosphere | KELAVSESTQDRPNESDEKAPTPGEEGTETVAGNPKKAPESKDGEQPSKQDQ* |
Ga0150985_1121304921 | 3300012212 | Avena Fatua Rhizosphere | PDEADEKAPKPGEQDTETVAGQPRKAPDSKDGEQSKQDA* |
Ga0150985_1122240492 | 3300012212 | Avena Fatua Rhizosphere | AMSESTQGQPAEADEKAQKPGEEDTETVAGVPKKAPDSKDGEQSKQDD* |
Ga0150985_1137509842 | 3300012212 | Avena Fatua Rhizosphere | VSESAQDQPDQADENAPKPGEEDTDTVAGTPKKAPDSKDGEQSKQNE* |
Ga0150985_1140319972 | 3300012212 | Avena Fatua Rhizosphere | EKAPKPGEQDTETVAGQPRKAPDSKDGEQSKQDA* |
Ga0150984_1053656493 | 3300012469 | Avena Fatua Rhizosphere | VSESTQDRPNESDEKAPTPGEEGTETVAGNPKKASESKDGEQPSKQDQ* |
Ga0150984_1063797381 | 3300012469 | Avena Fatua Rhizosphere | KEIAVSESTQDRPDKADENAPKPGEQDTETVAGQPKKAPASKEQSKQDE* |
Ga0150984_1115770251 | 3300012469 | Avena Fatua Rhizosphere | VSESTQNQPDQADENAPKPGEEDTETVAGVPNKAPDSKDGEQSKQDQ* |
Ga0150984_1151728462 | 3300012469 | Avena Fatua Rhizosphere | PDEADEKAPKPGEQDTETVAGVPKKAPESKDGEQSKQDE* |
Ga0150984_1170329901 | 3300012469 | Avena Fatua Rhizosphere | EKAPTPGESGTETVAGNPKKAPESKDGEQQSKQDQ* |
Ga0150984_1172688822 | 3300012469 | Avena Fatua Rhizosphere | EEIAVSESTQDQPDKTDDKAPKPGEQDTETVAGQPKKAPASKEQSKQDQ* |
Ga0150984_1174668211 | 3300012469 | Avena Fatua Rhizosphere | TEEVAVSESTQDQPDKADEQAPKPGEADTETVAGNPKKAPASKQQSKQDE* |
Ga0150984_1183609851 | 3300012469 | Avena Fatua Rhizosphere | DRVSESMQDRPDEAGEKAPKPGEDDTNTVAGVPQKAPDSKDDQSKQDQ* |
Ga0136614_107120381 | 3300012684 | Polar Desert Sand | MSESTQDRPDAADEKDPKPGEPDTETEGGFPKEAPD |
Ga0157285_103669601 | 3300012897 | Soil | DEKAPKKPGESDTETKAGFPKEAPESKDGEQSKQDE* |
Ga0182000_102654741 | 3300014487 | Soil | ANEEIAMSESTQDRPDEADEQAPKPGEPGTETVAGQPRKSPPESTDDGQEAKKDN* |
Ga0157377_100700854 | 3300014745 | Miscanthus Rhizosphere | VSESTQDRPAEADEKAPKPGEQDTETVAGAPKKAPASDGGEQSKQDE* |
Ga0132258_132899061 | 3300015371 | Arabidopsis Rhizosphere | MSDSTQDRTDEADEKATKPGEPDTDTMGGFPKEAPDDKDGGEQEPKKDH* |
Ga0136617_109984102 | 3300017789 | Polar Desert Sand | MSESTQDRPDEADEEKTPKPGEPDTETEGGFPKEAPDSKDG |
Ga0190265_118858001 | 3300018422 | Soil | VSESTQDRSEAEDKAPKPGEQDTETVAGQPRKAPESTD |
Ga0190270_127789501 | 3300018469 | Soil | VSDSTQDRTDETDEKAAKPGEQDTETVAGQPRKAPDSKDGE |
Ga0190274_109753041 | 3300018476 | Soil | MSESTQDRHDEADEKAPKPGEPDTETVAGVPKNAPESNDGEQQSKQDQ |
Ga0190274_122182032 | 3300018476 | Soil | MSESTQTPPDKADEQAAKPGEQDTETVAGQPRKAPKSKDGEQSKQDQ |
Ga0190264_100365331 | 3300019377 | Soil | MSESTQDRPDEADEKAPKPGEPDTETVAGVPKKAPESNDGEQQSKQDQ |
Ga0196962_100888971 | 3300024430 | Soil | VSESTQDRPDEADEKAPKPGQQDTDTVAGVPKKAPESKDGEQSKQDE |
Ga0196962_101027142 | 3300024430 | Soil | VSESTQDRPDGADEKAPKPGEQDTDTVAGVPKKAPESKDGEQSKQDQ |
Ga0207642_102900032 | 3300025899 | Miscanthus Rhizosphere | VSESTQDRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE |
Ga0207688_100387081 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VSESTQDRPAEADEKAPKPGEQGTETVAGAPKKAPASDGGEQSKQDE |
Ga0207643_108066662 | 3300025908 | Miscanthus Rhizosphere | VSESTQDRPAEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE |
Ga0207662_113235611 | 3300025918 | Switchgrass Rhizosphere | VSESTQGRPTEADEKSPKPGEQGTETVAGAPKKAPESDGGEQSKQDE |
Ga0207644_112220921 | 3300025931 | Switchgrass Rhizosphere | VSESTQDRPDEADEKAPKPGEQDTETVAGQPKKAPASKEQSKQDQ |
Ga0207661_114705082 | 3300025944 | Corn Rhizosphere | MSESTEHRPDEDDKATAKPGEQDTETVAGQPKKAPASKQQSKQDQEAG |
Ga0207712_112064012 | 3300025961 | Switchgrass Rhizosphere | VSESTQSRPQEVDEKAPKPGEKDTETVAGQPLKAPAHKDGEQSKQDEE |
Ga0207640_117952861 | 3300025981 | Corn Rhizosphere | VSESTQDRPDKADENAPKPGEQDTETVAGQPKKAPASKEQSKQDQ |
Ga0207708_118536452 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESTQTRPPEADEKVAKPGEPDTETVAGQPKKAPDSKDGKQSKQDQK |
Ga0207428_102465482 | 3300027907 | Populus Rhizosphere | VSESTKDRPNEVDENAPKPGEKDTKTVAGQPLKAPDHKQGEQSKQDE |
Ga0307321_10591471 | 3300028704 | Soil | MSESPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQTKQDQ |
Ga0307276_100719551 | 3300028705 | Soil | MSESPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQSKQDQ |
Ga0307322_100321382 | 3300028710 | Soil | QEQPDEADEKAPKPGEQDTETVAGVPKKAPDSKDGEQTKQDQ |
Ga0307313_100455502 | 3300028715 | Soil | MSESPQDKPDDADEKAPTPGEQDTETVAGVPKKAPDSKDGEQAKQDQ |
Ga0307315_101494572 | 3300028721 | Soil | EADEKAPTPGEQDTETVAGVPKKAPDSKDGEQAKQDQ |
Ga0307316_104086582 | 3300028755 | Soil | MSDTTQDRPDQPDEDAPKPGEPDTETLAGQPRKAPESKDGEQPSKQDQ |
Ga0307294_103237952 | 3300028810 | Soil | MSESPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQAKQDQ |
Ga0307314_101582051 | 3300028872 | Soil | SPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQTKQDQ |
Ga0307277_101641691 | 3300028881 | Soil | DKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEPSKQDQ |
Ga0307277_105880631 | 3300028881 | Soil | MSESPHDQPDEADEKAPKPGEQDTETVAGVPKEAPDSTDGEQSKQD |
Ga0308205_10488002 | 3300030830 | Soil | VAMSESPQDQPDEADEKAPKPGEQDTETVAGVPKKAPDSKDGEQAKQDQ |
Ga0308206_11360821 | 3300030903 | Soil | REVAMSESPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQTKQDQ |
Ga0308189_102529563 | 3300031058 | Soil | AMSESTQDRPDAADEKAPKPGEDDTETVAGQPKKAPDSKQPPKQVQ |
Ga0308201_101023271 | 3300031091 | Soil | AMSESPQDKPDEADEKAPTPGEQDTETVAGVPKKAPDSKDGEQTKQDQ |
Ga0299913_106323891 | 3300031229 | Soil | VSESTQDRPDEADEKAPKPGEQDTDTVAGVPKQAPESKDGEQSKQDQ |
Ga0307408_1018514122 | 3300031548 | Rhizosphere | VSESTQDRPDEADEKAPKPGEQDTETVAGQPRKAPDSKDGE |
Ga0307406_101176131 | 3300031901 | Rhizosphere | VSESTQDRPDEADEKAPKPGEQDTDTVAGVPKKAPESKDGEQSKQDQ |
Ga0307412_118055132 | 3300031911 | Rhizosphere | EADEKAPKPGEQDTDTVAGVPKKAPESKDGEQSKQDQ |
Ga0310906_114023021 | 3300032013 | Soil | TREVPMSESTHDRPDEADENAPKPGEPDTETVAGRPRKAPESKEGEQPSKQGE |
Ga0310890_106366911 | 3300032075 | Soil | MSESTHDRPDEADENAPKPGEPDTETVAGRPKKAPESKEGEQPSKQGE |
⦗Top⦘ |