 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F099328 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RIIQAGTADACFVFFNRRIFLGEDLRAAIVVQARRALFK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.80 % |
| % of genes from short scaffolds (< 2000 bps) | 2.91 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.204 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine (15.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (62.136 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00293 | NUDIX | 62.14 |
| PF02965 | Met_synt_B12 | 14.56 |
| PF01198 | Ribosomal_L31e | 9.71 |
| PF02219 | MTHFR | 6.80 |
| PF02574 | S-methyl_trans | 1.94 |
| PF13404 | HTH_AsnC-type | 0.97 |
| PF02607 | B12-binding_2 | 0.97 |
| PF00589 | Phage_integrase | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 14.56 |
| COG2097 | Ribosomal protein L31E | Translation, ribosomal structure and biogenesis [J] | 9.71 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 6.80 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.94 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.20 % |
| All Organisms | root | All Organisms | 6.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003498|JGI26239J51126_1012093 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2280 | Open in IMG/M |
| 3300007508|Ga0105011_1035514 | Not Available | 2508 | Open in IMG/M |
| 3300007509|Ga0105012_1048684 | Not Available | 2083 | Open in IMG/M |
| 3300007509|Ga0105012_1186101 | Not Available | 681 | Open in IMG/M |
| 3300014973|Ga0134293_1010395 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1391 | Open in IMG/M |
| (restricted) 3300024252|Ga0233435_1034822 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2138 | Open in IMG/M |
| 3300025623|Ga0209041_1018151 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2646 | Open in IMG/M |
| 3300027844|Ga0209501_10058830 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2759 | Open in IMG/M |
| 3300028175|Ga0257117_1008031 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 4208 | Open in IMG/M |
| 3300028706|Ga0257115_1142902 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 15.53% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 12.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.65% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 10.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 5.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 5.83% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 4.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.91% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.94% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 1.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.94% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.94% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.97% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.97% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.97% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.97% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2049941003 | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 420 | Environmental | Open in IMG/M |
| 3300000146 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 120m | Environmental | Open in IMG/M |
| 3300002533 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_80 | Environmental | Open in IMG/M |
| 3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300002919 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003495 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
| 3300003501 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005237 | Groundwater microbial communities from aquifer - Crystal Geyser CG15_big_fil_post_rev_8/21/14_0.20 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006079 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D | Environmental | Open in IMG/M |
| 3300006465 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX | Environmental | Open in IMG/M |
| 3300006468 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451 | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300008254 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN4B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008738 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009332 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009339 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009408 | Marine microbial mats from Loihi Seamount, Hawaii, USA. Combined Assembly of Gp0139187, Gp0139188, Gp0139189, Gp0139190, Gp0139191, Gp0139192 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010967 | Microbial communities from the inside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.in | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300014973 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubation | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
| 3300022912 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MG | Environmental | Open in IMG/M |
| 3300022916 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MG | Environmental | Open in IMG/M |
| 3300024252 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MG | Environmental | Open in IMG/M |
| 3300024257 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MG | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024327 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MG | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025142 | Groundwater microbial communities from aquifer - Crystal Geyser CG11_big_fil_rev_8/21/14_0.20 (SPAdes) | Environmental | Open in IMG/M |
| 3300025431 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025468 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_120m (SPAdes) | Environmental | Open in IMG/M |
| 3300025545 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025623 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025656 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m (SPAdes) | Environmental | Open in IMG/M |
| 3300025662 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025673 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes) | Environmental | Open in IMG/M |
| 3300025709 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025727 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025729 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027228 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028174 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_135 | Environmental | Open in IMG/M |
| 3300028175 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_135m | Environmental | Open in IMG/M |
| 3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
| 3300028706 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100m | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GB_4MN_00534160 | 2049941003 | Hydrothermal Vents | MIQAGTGDVCLVFLSRRIFLGEDLRAAIDFQARRALFK |
| SI54feb11_120mDRAFT_100002624 | 3300000146 | Marine | MIQAGTAEVCFVFLSRRIFRGEDLRAAIISQARRALFK* |
| JGI24925J35515_10027223 | 3300002533 | Marine | LVLTXLLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK* |
| JGI26060J43896_100532061 | 3300002913 | Marine | LFVFRIIQAGTAEVCFVFFNRRIFLGDDLRAAIVSQARRALFK* |
| JGI26061J44794_10582061 | 3300002919 | Marine | VLTARFVLRIIQAGTGTACLVFFNRRIFLGEDLRAAIEFQARRALFK* |
| JGI26244J51143_10375383 | 3300003495 | Marine | PLLVLRIIQAGTADVCFVFFNKRIFRGEDLRAAIDFQARRALFK* |
| JGI26239J51126_10120931 | 3300003498 | Marine | GLVLTALFVLRIIQAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK* |
| JGI26243J51142_10065906 | 3300003501 | Marine | LVLTALLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK* |
| JGI26243J51142_10635402 | 3300003501 | Marine | VLTLLLVFRIIQAGTAEACFVFFSRRIFLGEDLRAAIDVQARKALFK* |
| Ga0055439_102384621 | 3300004019 | Natural And Restored Wetlands | FDLTVLFVFKIIQAGTGDVCLVFFSRRIFRGDDLRAAINVQAR* |
| Ga0068996_101570531 | 3300005218 | Natural And Restored Wetlands | TVLFVFKIIQAGTGDVCLVFFSRRIFRGDDLRAAINVQAR* |
| Ga0066644_101065571 | 3300005237 | Groundwater | TAEVCLVFFNRRIFLGEDLRAAIDFQARRALFKSCVRIGRTQ* |
| Ga0074476_10897632 | 3300005825 | Sediment (Intertidal) | RIIQAGTAEVCLVFFNRRIFLGEDLRAAIDFQARKALFK* |
| Ga0066375_100899993 | 3300006019 | Marine | RFVLRIIQAGTGTACFVFFSRRIFLGEDLRAAIEFQARRALFK* |
| Ga0081601_12535492 | 3300006079 | Diffuse Hydrothermal Fluid | AGTAEVCFVFLSRRIFLGEDLRAAIVCQARRALFK* |
| Ga0082250_100029002 | 3300006465 | Sediment | LRMIQAGTGDVCLVFLRRRIFRGEDLRAAIDCQARRALFK* |
| Ga0082251_100416054 | 3300006468 | Sediment | LGLVRTVLLVLIITQAGTGLVCLVFFNRRIFLGDDLRAAID* |
| Ga0105011_10355144 | 3300007508 | Marine | LGLVLTDLFVLRIIHAGTGDVSFVFFNKRIFLPERLRAAIKSQA* |
| Ga0105012_10486844 | 3300007509 | Marine | LGLVLTDLFVLRIIHAGTGDVSFVFFNKRIFLPERLRAAMKSQA* |
| Ga0105012_11861011 | 3300007509 | Marine | RLGLVLTDLFVLRIIHAGTGDVSFVFFNKRIFLPERLRAAMKSQA* |
| Ga0102904_10278773 | 3300007981 | Estuarine | LVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK* |
| Ga0105351_11866922 | 3300008254 | Methane Seep Mesocosm | QAGTAEACFVFLSRRIFLGEDLRAAIVCQARRALFK* |
| Ga0115660_11857561 | 3300008738 | Marine | TDLFVLRIIHAGTGDVSFVFFNKRIFLPERLRAAMKSQA* |
| Ga0102887_11041011 | 3300008961 | Estuarine | TLLLVFRIIQAGTAEACFVFFSRRIFLGEDLRAAIDVQARKALFK* |
| Ga0117915_10722781 | 3300009332 | Marine | TPLFVLRIIQAGTAEVCFVFFNKRIFRGEDLRAAISFQARRALFK* |
| Ga0117928_10946413 | 3300009339 | Marine | RIIQAGTADACFVFFNRRIFLGEDLRAAIVVQARRALFK* |
| Ga0117756_10993061 | 3300009408 | Marine | VLTLLLVLRIIQAGTADVCFVFFNRRIFRGEDLRAAIEFQARRALFK* |
| Ga0114997_103725942 | 3300009425 | Marine | GTADVCFVFFNKRIFLGEDFRAAIDCQARRALFK* |
| Ga0115007_101564761 | 3300009441 | Marine | VLRMIQAGTADVCFVFFNRRIFLGEDFRAAIDCQARRALFK* |
| Ga0114932_108048041 | 3300009481 | Deep Subsurface | AGTAVACFVFFNRRIFRGEDLRAAIEFQARRALFK* |
| Ga0115568_104502261 | 3300009498 | Pelagic Marine | TVLLVLRMIQAGTADVCFVFFNKRIFLGEDFRAAIDCQARRALFK* |
| Ga0115002_106277382 | 3300009706 | Marine | LRIIQAGTADVCFVFFNRRIFLGEDLREAIDCQARRALFK* |
| Ga0114999_113101832 | 3300009786 | Marine | LVLRIIQAGTADVCFVFFNRRIFLGEDLRAAIVCQARKALFK* |
| Ga0118733_1044296762 | 3300010430 | Marine Sediment | LFVLRIIHAGTAEVCLVFFNRRIFLGEDLRAAIDFQARRALFK* |
| Ga0139247_10211261 | 3300010967 | Hydrothermal Chimney Microbial Mat | VLRIIHAGTAEVCLVFFRRRIFLGEDLRAAIDFQARGALFK* |
| Ga0139246_11237841 | 3300010969 | Hydrothermal Chimney Microbial Mat | TPRLVLRIIHAGTAEVCLVFFRRRIFLGEDLRAAIDFQARGALFK* |
| Ga0134293_10103951 | 3300014973 | Marine | LVLTALLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK* |
| Ga0211694_103123761 | 3300020464 | Marine | IQAGTAVACFVFFSRRIFLGEDLRAAIVFQARRALFK |
| Ga0206686_10000237 | 3300021065 | Seawater | MIQAGTAEVCFVFLSRRIFRGEDLRAAIISQARRALFK |
| Ga0206684_12388492 | 3300021068 | Seawater | LVLRIIQAGTADVCFIFFNKRIFLGDDLRAAIVCQARKALFK |
| Ga0206678_102577891 | 3300021084 | Seawater | LLVLRIIQAGTADVCFVFFNKRIFLGEDLRAAIDCQARKALFK |
| Ga0206683_103338102 | 3300021087 | Seawater | AGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK |
| Ga0224503_103268971 | 3300022201 | Sediment | FVLRIIHAGTAEVCLVFLSKRIFLGEDLRAAIDFQARGALFK |
| Ga0224498_100125691 | 3300022202 | Sediment | HAGTAEVCLVFFNRRIFLGEDLRAAIDFQARRALFK |
| Ga0224513_100049091 | 3300022220 | Sediment | LVLRIIQAGTGEACFVFFSRRIFLGEDLRAAIDFQARRALFK |
| Ga0224506_100793301 | 3300022221 | Sediment | LFVLRIIQAGTGDACLVFFRRRIFLGDDLRAAIVFQARRALFK |
| Ga0224508_101458471 | 3300022413 | Sediment | IIQAGTGEACFVFFSRRIFLGEDLRAAIDFQARRALFK |
| Ga0224508_108528832 | 3300022413 | Sediment | TAEVCLVFFNRRIFLGEDLRAAIDFQARRALFKPCVQICGA |
| (restricted) Ga0233429_10160655 | 3300022902 | Seawater | QAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK |
| (restricted) Ga0233430_11740453 | 3300022912 | Seawater | IIQAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| (restricted) Ga0233431_11371083 | 3300022916 | Seawater | AGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| (restricted) Ga0233431_12949631 | 3300022916 | Seawater | LVLTALLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQ |
| (restricted) Ga0233435_10348224 | 3300024252 | Seawater | LVLTALLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK |
| (restricted) Ga0233435_10879091 | 3300024252 | Seawater | QAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| (restricted) Ga0233442_10201374 | 3300024257 | Seawater | ALFVLRIIQAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| (restricted) Ga0233442_10526001 | 3300024257 | Seawater | RIIHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| (restricted) Ga0233441_11440161 | 3300024260 | Seawater | VFKIIHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| (restricted) Ga0233439_100963543 | 3300024261 | Seawater | IHAGTAEACFVFFNKRIFLGEDLRAAIDVQARRALFK |
| (restricted) Ga0233434_10539024 | 3300024327 | Seawater | VLTLLLVFRIIQAGTAEACFVFFSRRIFLGEDLRAAIDVQARKALFK |
| (restricted) Ga0255056_102327893 | 3300024521 | Seawater | LVLRITQAGTAEVCLVFFNRRIFLGEDLRAAIDFEPRRALFK |
| (restricted) Ga0255056_105533261 | 3300024521 | Seawater | IQAGTGDVCLVFLRRRIFRGEDLRAAIDCQARRALFK |
| Ga0210019_10586541 | 3300025142 | Groundwater | IHAGTAEVCLVFFNRRIFLGEDLRAAIDFQARRALFKSCVRIGRTQ |
| Ga0209449_10845091 | 3300025431 | Marine | LVLTALLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQ |
| Ga0209685_10228733 | 3300025468 | Marine | AGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0209142_10459363 | 3300025545 | Marine | MIQAGTADVCFVFFNKRIFLGDDFRAAIDCQARRALFK |
| Ga0209658_10172484 | 3300025592 | Marine | QAGTADVCFVFFNKRIFRGEDLRAAIDFQARRALFK |
| Ga0209041_10181514 | 3300025623 | Marine | LVLTALFVLRIIHAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0209054_10125381 | 3300025656 | Marine | KIIHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| Ga0209664_11170111 | 3300025662 | Marine | FVFRIIHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| Ga0209494_11607332 | 3300025673 | Methane Seep Mesocosm | LLVLSIIQAGTAVACFVFFSRRIFLGEDLRAAIVFQARRALFK |
| Ga0209044_10036641 | 3300025709 | Marine | IIHAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0209305_10072866 | 3300025712 | Pelagic Marine | SIIQAGTAVACFVFFSRRIFLGEDLRAAIVFQARRALFK |
| Ga0209047_10258641 | 3300025727 | Marine | RIIHAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0209558_10250481 | 3300025729 | Marine | VLTALFVLRIIHAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0210124_11238831 | 3300026007 | Natural And Restored Wetlands | TQAGTGEVCFVFFNRRIFLGDDLRAAIDFEPRRALFK |
| Ga0208308_10458242 | 3300027228 | Estuarine | RIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK |
| Ga0208950_11208162 | 3300027413 | Marine | LVLTALLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK |
| Ga0208971_11363651 | 3300027582 | Marine | LVLTLLLVFRIIQAGTAEACFVFFSRRIFLGEDLRAAIDVQARKALFK |
| Ga0209302_102197903 | 3300027810 | Marine | LVLRIIQAGTAVACFVFFNKRIFLGEDLRAAIVCQARKALFK |
| Ga0209090_105559421 | 3300027813 | Marine | LLVLRIIQAGTADVCFVFFNKRIFLGEDLRAAIVCQARKALFK |
| Ga0209035_101044613 | 3300027827 | Marine | AGTAEVCFVFFNRRIFRGDDLRAAIVSQARRALFK |
| Ga0209501_100588301 | 3300027844 | Marine | LVLTALLVLRIIQAGTADVCFVFFNKRIFRGEDLRAAIDCQARKALFK |
| Ga0209272_102754651 | 3300027967 | Marine Sediment | HAGTAEVCLVFLSRRIFLGEDLRAAIDFQARRALFK |
| Ga0257123_10874973 | 3300028174 | Marine | MIQAGTADVCFVFFNKRIFLGDDFRAAIDCQARRAL |
| Ga0257123_11084731 | 3300028174 | Marine | FVLRIIQAGTAEVCFVFFNKRIFRGEDLRAAISFQARRALFK |
| Ga0257117_10080315 | 3300028175 | Marine | GLVLTALFVLRIIQAGTGDACLVFFNRRIFRGEDLRAAIEFQARRALFK |
| Ga0257121_12605551 | 3300028198 | Marine | IHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| Ga0257115_11429021 | 3300028706 | Marine | LVLTDLLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK |
| Ga0308010_10635693 | 3300031510 | Marine | MIQAGTADVCFVFFNKRIFLGEDFRAAIDCQARRALFK |
| Ga0302137_12316161 | 3300031588 | Marine | LVLTDLLVLRIIQAGTAVVCFVFFNKRIFLGEDLRAAIVCQARKA |
| Ga0315332_105148462 | 3300031773 | Seawater | AGTADACFVFFNKRIFLGEDLRAAIDVQARRALFK |
| Ga0315326_109137602 | 3300031775 | Seawater | AGTADVCFVFFNKRIFRGEDLRAAIDCQARKALFK |
| Ga0310120_102950433 | 3300031803 | Marine | TVLLVLRIIQAGTADVCFVFFNKRIFLGVDLRAAIVCQARKALFK |
| Ga0310120_103292471 | 3300031803 | Marine | LLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK |
| Ga0315318_101001544 | 3300031886 | Seawater | LTLLFVFRIIQAGTADACFVFFNKRIFLGEDLRAAIDVQARRALFK |
| Ga0315278_120875562 | 3300031997 | Sediment | DLTVLFVFRIIQAGTGDACLVFFNRRIFLGDDLRAAINIQAR |
| Ga0315315_111164872 | 3300032073 | Seawater | LLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALFK |
| Ga0315315_115076111 | 3300032073 | Seawater | LVLTALLVLRIIQAGTADACFVFFNNRIFLGEDLRAAIVCQARKALF |
| Ga0315333_100681411 | 3300032130 | Seawater | IIHAGTAEACFVFFNRRIFLGEDLRAAIDVQARRALFK |
| Ga0316202_100170671 | 3300032277 | Microbial Mat | IHAGTADVCLVFLSRRIFLGEDLRAAIDFQARRALFK |
| Ga0315334_107102333 | 3300032360 | Seawater | TALLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALFK |
| Ga0315334_111387721 | 3300032360 | Seawater | RIIHAGTAEACFVFFNKRIFLGDDLRAAIDVQARRALFK |
| Ga0315334_112428681 | 3300032360 | Seawater | LVLTDLLVLRIIQAGTADACFVFFNKRIFLGEDLRAAIVCQARKALF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |