Basic Information | |
---|---|
Family ID | F099632 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQAANP |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.17 % |
% of genes near scaffold ends (potentially truncated) | 99.03 % |
% of genes from short scaffolds (< 2000 bps) | 97.09 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.087 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (11.650 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.427 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.961 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00313 | CSD | 6.80 |
PF12697 | Abhydrolase_6 | 2.91 |
PF08332 | CaMKII_AD | 2.91 |
PF04964 | Flp_Fap | 1.94 |
PF00270 | DEAD | 1.94 |
PF09722 | Xre_MbcA_ParS_C | 1.94 |
PF13581 | HATPase_c_2 | 1.94 |
PF13545 | HTH_Crp_2 | 0.97 |
PF07883 | Cupin_2 | 0.97 |
PF13561 | adh_short_C2 | 0.97 |
PF13420 | Acetyltransf_4 | 0.97 |
PF02639 | DUF188 | 0.97 |
PF07750 | GcrA | 0.97 |
PF07589 | PEP-CTERM | 0.97 |
PF13602 | ADH_zinc_N_2 | 0.97 |
PF02518 | HATPase_c | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 2.91 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 1.94 |
COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 0.97 |
COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.09 % |
Unclassified | root | N/A | 2.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12498386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 687 | Open in IMG/M |
3300001989|JGI24739J22299_10091386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 927 | Open in IMG/M |
3300002239|JGI24034J26672_10041715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 772 | Open in IMG/M |
3300002568|C688J35102_118862867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 606 | Open in IMG/M |
3300002568|C688J35102_120144175 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300004156|Ga0062589_100656247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 922 | Open in IMG/M |
3300004463|Ga0063356_105480424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 545 | Open in IMG/M |
3300004643|Ga0062591_101394746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 694 | Open in IMG/M |
3300004643|Ga0062591_102465323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 546 | Open in IMG/M |
3300005093|Ga0062594_101796265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 645 | Open in IMG/M |
3300005288|Ga0065714_10285390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 716 | Open in IMG/M |
3300005327|Ga0070658_10468930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1086 | Open in IMG/M |
3300005327|Ga0070658_10712365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 871 | Open in IMG/M |
3300005333|Ga0070677_10209421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300005334|Ga0068869_101983562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
3300005339|Ga0070660_101468594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 580 | Open in IMG/M |
3300005434|Ga0070709_10841980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 722 | Open in IMG/M |
3300005435|Ga0070714_102293469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 525 | Open in IMG/M |
3300005458|Ga0070681_11308121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 648 | Open in IMG/M |
3300005459|Ga0068867_100964321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 771 | Open in IMG/M |
3300005535|Ga0070684_101508093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 634 | Open in IMG/M |
3300005547|Ga0070693_101057337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 617 | Open in IMG/M |
3300005549|Ga0070704_101310445 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005564|Ga0070664_101006179 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005564|Ga0070664_101301619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 686 | Open in IMG/M |
3300005564|Ga0070664_101651657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 607 | Open in IMG/M |
3300005578|Ga0068854_100045071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3134 | Open in IMG/M |
3300005578|Ga0068854_100868448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 791 | Open in IMG/M |
3300005587|Ga0066654_10847340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
3300005834|Ga0068851_10320467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 895 | Open in IMG/M |
3300005840|Ga0068870_10477173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 827 | Open in IMG/M |
3300006175|Ga0070712_101282278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 638 | Open in IMG/M |
3300006806|Ga0079220_10952051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 674 | Open in IMG/M |
3300009101|Ga0105247_10819451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 712 | Open in IMG/M |
3300010044|Ga0126310_11033069 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300010401|Ga0134121_10282402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus sphagnicola | 1463 | Open in IMG/M |
3300012212|Ga0150985_116324657 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012469|Ga0150984_101899446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 732 | Open in IMG/M |
3300012469|Ga0150984_111767738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 595 | Open in IMG/M |
3300012955|Ga0164298_11689530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 502 | Open in IMG/M |
3300012986|Ga0164304_10451606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
3300012989|Ga0164305_10475741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 977 | Open in IMG/M |
3300013104|Ga0157370_10818733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 847 | Open in IMG/M |
3300013104|Ga0157370_11305710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 654 | Open in IMG/M |
3300013296|Ga0157374_12922407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 505 | Open in IMG/M |
3300013307|Ga0157372_10696247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1182 | Open in IMG/M |
3300013307|Ga0157372_10696276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1182 | Open in IMG/M |
3300014497|Ga0182008_10248686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 916 | Open in IMG/M |
3300015371|Ga0132258_10439009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 3252 | Open in IMG/M |
3300015372|Ga0132256_103299646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 543 | Open in IMG/M |
3300015374|Ga0132255_102377621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 809 | Open in IMG/M |
3300015374|Ga0132255_102658747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 765 | Open in IMG/M |
3300018073|Ga0184624_10458105 | Not Available | 559 | Open in IMG/M |
3300018920|Ga0190273_10653487 | Not Available | 805 | Open in IMG/M |
3300020076|Ga0206355_1223930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1572 | Open in IMG/M |
3300020078|Ga0206352_10950040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 561 | Open in IMG/M |
3300025903|Ga0207680_10775157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 687 | Open in IMG/M |
3300025903|Ga0207680_11330606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 510 | Open in IMG/M |
3300025904|Ga0207647_10637179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 585 | Open in IMG/M |
3300025904|Ga0207647_10752809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 527 | Open in IMG/M |
3300025912|Ga0207707_10295401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1401 | Open in IMG/M |
3300025913|Ga0207695_10244682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1694 | Open in IMG/M |
3300025917|Ga0207660_10150743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1786 | Open in IMG/M |
3300025923|Ga0207681_11682669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 530 | Open in IMG/M |
3300025924|Ga0207694_10657774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33 | 883 | Open in IMG/M |
3300025928|Ga0207700_10359565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1269 | Open in IMG/M |
3300025929|Ga0207664_11289608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 650 | Open in IMG/M |
3300025930|Ga0207701_10172327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1912 | Open in IMG/M |
3300025931|Ga0207644_11291933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33 | 613 | Open in IMG/M |
3300025932|Ga0207690_10364822 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300025932|Ga0207690_10600745 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300025932|Ga0207690_10634899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 874 | Open in IMG/M |
3300025933|Ga0207706_10015018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 7012 | Open in IMG/M |
3300025933|Ga0207706_10522122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
3300025933|Ga0207706_10546350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 997 | Open in IMG/M |
3300025935|Ga0207709_10249255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1296 | Open in IMG/M |
3300025935|Ga0207709_10582802 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300025938|Ga0207704_10771009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 801 | Open in IMG/M |
3300025960|Ga0207651_10127702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1940 | Open in IMG/M |
3300025960|Ga0207651_10267792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
3300025972|Ga0207668_11240881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 670 | Open in IMG/M |
3300026089|Ga0207648_10773819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300026319|Ga0209647_1156149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 947 | Open in IMG/M |
3300027842|Ga0209580_10285095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp. | 822 | Open in IMG/M |
3300028379|Ga0268266_10305728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1485 | Open in IMG/M |
3300028380|Ga0268265_11992437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 588 | Open in IMG/M |
3300028381|Ga0268264_12344758 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300028590|Ga0247823_10850356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 685 | Open in IMG/M |
3300031548|Ga0307408_101659111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 608 | Open in IMG/M |
3300031720|Ga0307469_11701079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 608 | Open in IMG/M |
3300031731|Ga0307405_11673456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 563 | Open in IMG/M |
3300031852|Ga0307410_10272408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
3300031852|Ga0307410_11723222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 555 | Open in IMG/M |
3300031903|Ga0307407_11536310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 527 | Open in IMG/M |
3300031903|Ga0307407_11552614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 524 | Open in IMG/M |
3300031911|Ga0307412_10216562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1465 | Open in IMG/M |
3300031939|Ga0308174_11754316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 533 | Open in IMG/M |
3300031995|Ga0307409_102612873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 533 | Open in IMG/M |
3300032002|Ga0307416_100617125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1166 | Open in IMG/M |
3300032013|Ga0310906_10170581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1291 | Open in IMG/M |
3300032013|Ga0310906_10736846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 691 | Open in IMG/M |
3300032122|Ga0310895_10449185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 640 | Open in IMG/M |
3300032421|Ga0310812_10033814 | Not Available | 1891 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 11.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.88% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.97% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.97% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_124983863 | 3300000789 | Soil | VEAVGSAENWHEERDRLVKLLEGIETGKITHIDENDLGQLQATNPE |
JGI24739J22299_100913864 | 3300001989 | Corn Rhizosphere | MEVIVSVENWHEERDRLVQLLRGIESGEITHIDEDDLREL |
JGI24034J26672_100417151 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAENWHEERDRLVRLLNAIESGKVTHIDEEDMRQLQATTPENVEALK |
C688J35102_1188628671 | 3300002568 | Soil | MGAENWHEERDRLIQLLKGIESGTITHIDEDDLRELQATSPENIAV |
C688J35102_1201441751 | 3300002568 | Soil | MEGAVSTENWTDERERLVKLLEGIDSGTVTHVDEEDFEQLQATNP |
Ga0062589_1006562471 | 3300004156 | Soil | VSAENWHQERDRLVRLLKAIKSGKITHIDEVDLRELQAANPENIAALE |
Ga0063356_1054804243 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LQVEAEDIVSAENWHEERDRLVRLLKAIETGKVTHVDEED |
Ga0062591_1013947463 | 3300004643 | Soil | MAENWHQERDRLVHLLRAIEMGEVTHIDETDFRQLQATNPDNVASLKQR |
Ga0062591_1024653231 | 3300004643 | Soil | VSAENWHDERDRLVRLLKAIESGEVTHVDEEDMRQLQATTPENIE |
Ga0062594_1017962651 | 3300005093 | Soil | VSAENWHEERDRLVRLLKAIESGKVTHIDQSGDRQLQATNPENIVA |
Ga0065714_102853901 | 3300005288 | Miscanthus Rhizosphere | MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAA |
Ga0070658_104689305 | 3300005327 | Corn Rhizosphere | VSTENWAEERDRIVKLLEAIEAGTVTHIDEDELRQLQATTEDNVA |
Ga0070658_107123651 | 3300005327 | Corn Rhizosphere | VSVENWHEERDRLIELLEAIESGKVSHIDEEDLRQLQPTNPENI |
Ga0070677_102094211 | 3300005333 | Miscanthus Rhizosphere | VSAENWHEERDRLVKLLEGIETGKITHIDENDLRQLQATNEENIALLKE |
Ga0068869_1019835623 | 3300005334 | Miscanthus Rhizosphere | MSENWHDERDRLVRLLKAIESGKVTHVDEEDRRQLQATTPENIEGLK |
Ga0070660_1014685942 | 3300005339 | Corn Rhizosphere | VSTENWAEERARLERLLVDIESGKITHVDEEDLRQLQAINPGNIAAL |
Ga0070709_108419803 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VENWHEERDRLMQLLEGIESGKITHIDEADLRELQATSPENIA |
Ga0070714_1022934691 | 3300005435 | Agricultural Soil | VSAENWHEERDRLIELLEAIESGKVTHIDEEGLRQLQPTN |
Ga0070681_113081211 | 3300005458 | Corn Rhizosphere | MVNAENWHEERDRLVELLQGIESGKITHIDEEDLRELQAT |
Ga0068867_1009643211 | 3300005459 | Miscanthus Rhizosphere | MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAAT |
Ga0070684_1015080931 | 3300005535 | Corn Rhizosphere | VENWHEERDRLMQLLEGIESGKITHIDEADLRELQATSPENIAL |
Ga0070693_1010573371 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAESWHEERDRLVELLEAIESGKVTHIDEEDLRQLQPTNPENIA |
Ga0070704_1013104452 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPENIAVLKKR |
Ga0070664_1010061792 | 3300005564 | Corn Rhizosphere | VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPE |
Ga0070664_1013016191 | 3300005564 | Corn Rhizosphere | VTENWHEERDRLIKLLEGIGSGKITHIDEKELRQLQATNPENVALLRERLA |
Ga0070664_1016516571 | 3300005564 | Corn Rhizosphere | VSAENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQPTNP |
Ga0068854_1000450711 | 3300005578 | Corn Rhizosphere | VSAENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQPTN |
Ga0068854_1008684483 | 3300005578 | Corn Rhizosphere | VSAENWHEERDRLVQLLEGIESGKITHIDEADLRQLQATSPE |
Ga0066654_108473402 | 3300005587 | Soil | VSAENWHEERDRLSLLLQGIESGAVTHIDEEDLRQL |
Ga0068851_103204671 | 3300005834 | Corn Rhizosphere | VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVARL |
Ga0068870_104771733 | 3300005840 | Miscanthus Rhizosphere | VSENWREERDRLIRLLAAIESGKITHVDEENLRQLQATSPENIELLKKR |
Ga0070712_1012822781 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGENWHQERDRLVQLLKGIESGAITHIDKEDRQQLQA |
Ga0079220_109520512 | 3300006806 | Agricultural Soil | VSEENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQ |
Ga0105247_108194511 | 3300009101 | Switchgrass Rhizosphere | VSAENWHEERERLIRLLKAIKSGKVTHIDEEDLRQLQATNPD |
Ga0126310_110330691 | 3300010044 | Serpentine Soil | VSAENWHEERDRLVQLLEAIESGRITHIDEEDLRQLQATNP |
Ga0134121_102824023 | 3300010401 | Terrestrial Soil | MSAENWHEERDRLVRLLKAIESGKITHIDEEDLRQLQATNPD |
Ga0150985_1163246571 | 3300012212 | Avena Fatua Rhizosphere | LSENWHEERDRLVALIEAVENGDVTHIDQGQLRQLQQ |
Ga0150984_1018994463 | 3300012469 | Avena Fatua Rhizosphere | MEAALSAENWHEERDRLVRLIKAIESGKVSHIDEEDLRQLQAT |
Ga0150984_1117677381 | 3300012469 | Avena Fatua Rhizosphere | VSAETWHEERERLVRLLKAIESGDVTHIDQEGLRPLQATNPENVVVLK |
Ga0164298_116895301 | 3300012955 | Soil | MVSAENWHEERDRLVQLLKGIESGAITHIDEEDLRELQATSPENVELL |
Ga0164304_104516063 | 3300012986 | Soil | MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQPTNP |
Ga0164305_104757411 | 3300012989 | Soil | MVSAENWHEERDRLVQLLKGIESGAITHIDEEDLRELQATSPENV |
Ga0157370_108187333 | 3300013104 | Corn Rhizosphere | MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSPKNIAMLKNR |
Ga0157370_113057101 | 3300013104 | Corn Rhizosphere | VSVENWHEERERLVQLLEGIESGKITHIDVEDLRELQA |
Ga0157374_129224072 | 3300013296 | Miscanthus Rhizosphere | MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSPKNI |
Ga0157372_106962474 | 3300013307 | Corn Rhizosphere | VSAENWHEERDRLIELLEAIESGKVTHIDEEDMRQLQP |
Ga0157372_106962765 | 3300013307 | Corn Rhizosphere | VSVENWHEERERLVQLLEGIESGKITHIDVEDLRELQATSP |
Ga0182008_102486863 | 3300014497 | Rhizosphere | VSVENWHEERDRLVKLLKGIESGKITHVDENGLRQLQATNPENIAWIK |
Ga0132258_104390091 | 3300015371 | Arabidopsis Rhizosphere | MLPDRVAEVVVSAENWHEERDRLVRLLKAIETGDVTHIDEDDMRQLQAT |
Ga0132256_1032996463 | 3300015372 | Arabidopsis Rhizosphere | MAENWHQERDRLVHLLRAIEMGEVTHIDETDLRQLQATNPDNVA |
Ga0132255_1023776214 | 3300015374 | Arabidopsis Rhizosphere | MSAETWHEERDRLVRLLEAIKSGDVTHIDEQDQRQLQET |
Ga0132255_1026587471 | 3300015374 | Arabidopsis Rhizosphere | VSEENWHEERDRLVELLEAVESGTVTHIDEEDLRQLQPTNPDNIAVLRE |
Ga0184624_104581052 | 3300018073 | Groundwater Sediment | MENPVSTENWAEERDRLRQLLNDFESGKITHFDEGDDG |
Ga0190273_106534871 | 3300018920 | Soil | MSTETWSEERARLLRLLDGIESGEITHINEGDLRE |
Ga0206355_12239301 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVARLKD |
Ga0206352_109500402 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPD |
Ga0207680_107751573 | 3300025903 | Switchgrass Rhizosphere | MTAETWHEERDRLVLLLEGIKAGRITHIDEKDQRELKP |
Ga0207680_113306062 | 3300025903 | Switchgrass Rhizosphere | MSAENWHEERDRLVQLLEGIESGKVTHIDESDDRQLEAANPKN |
Ga0207647_106371791 | 3300025904 | Corn Rhizosphere | VTSENWHEERDRLVELLAGIESGRITHIDVDNLRQLRATSPQNIAVVR |
Ga0207647_107528091 | 3300025904 | Corn Rhizosphere | MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQPTNPDNIAIL |
Ga0207707_102954015 | 3300025912 | Corn Rhizosphere | VSVENWHEERDRLAQLLKGIESGKITHIDEADLRE |
Ga0207695_102446821 | 3300025913 | Corn Rhizosphere | VSAENWHEERNRIVELLEAIESGKVTHIDEENLRQLAPTNPKNIALLRKG |
Ga0207660_101507436 | 3300025917 | Corn Rhizosphere | VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVAR |
Ga0207681_116826691 | 3300025923 | Switchgrass Rhizosphere | VSAENWHDERDRLVRLLKAIESGEVTHVDEEDMRQLQATTPENIET |
Ga0207694_106577742 | 3300025924 | Corn Rhizosphere | MSAENWHEERDRLVRLLKAIESGKITHIDEEDLRQLQATNPDTI |
Ga0207700_103595651 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGENWREERDRLVQLLEGIESGKVTHIDEADLRELQATTPENIEVLKK |
Ga0207664_112896081 | 3300025929 | Agricultural Soil | VSAENWHEERDRLIELLEAIESGKVTHIDEEGLRQL |
Ga0207701_101723271 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAENWHEERDRIVQLLSGIESGKITHIDEKDLRELQATSPEN |
Ga0207644_112919331 | 3300025931 | Switchgrass Rhizosphere | MSAENWHEERDRLVRLLKAIESGKITHIDERDLRVLQAATPENIAALKQR |
Ga0207690_103648222 | 3300025932 | Corn Rhizosphere | VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPENIAMLKKR |
Ga0207690_106007451 | 3300025932 | Corn Rhizosphere | VTAENWHEERDRLIQLLQGIESGRITHIDEDDLRQ |
Ga0207690_106348991 | 3300025932 | Corn Rhizosphere | VSVENWHEERDRLIELLEAIESGKVSHIDEEDLRQLQPTNPENIALL |
Ga0207706_1001501813 | 3300025933 | Corn Rhizosphere | VSAENWHEERDRLVRLLNAIESGKVTHIDEEDMRQL |
Ga0207706_105221221 | 3300025933 | Corn Rhizosphere | MEAAVSAENWHEERDRIAQLLDGIESGKITHIDEEDLRQLQATNPENVALL |
Ga0207706_105463504 | 3300025933 | Corn Rhizosphere | VSVENWHEERDRLVQLLRGIESGEITHIDEDDLRELQAT |
Ga0207709_102492555 | 3300025935 | Miscanthus Rhizosphere | VSENWREERDRLVRLLAAIESGEITHIDEADQRQLQAASPENI |
Ga0207709_105828021 | 3300025935 | Miscanthus Rhizosphere | VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQ |
Ga0207704_107710093 | 3300025938 | Miscanthus Rhizosphere | VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQAANP |
Ga0207651_101277021 | 3300025960 | Switchgrass Rhizosphere | VSENWREERDRLIRLLAAIESGKITHVDEENLRQLQATSPENI |
Ga0207651_102677924 | 3300025960 | Switchgrass Rhizosphere | MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQP |
Ga0207668_112408813 | 3300025972 | Switchgrass Rhizosphere | MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSP |
Ga0207648_107738191 | 3300026089 | Miscanthus Rhizosphere | MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATP |
Ga0209647_11561491 | 3300026319 | Grasslands Soil | VSVENWHEERDRLARLLKAVESGKITHVDEEDLRQLQA |
Ga0209580_102850953 | 3300027842 | Surface Soil | VSTENWHEERDRLRQLLKGIESGKITHIDEDDLRQLQ |
Ga0268266_103057282 | 3300028379 | Switchgrass Rhizosphere | MSPENWHEERDRLIKLLEGIESGEVTHVDESIDRQLEATNPKNVAG |
Ga0268265_119924371 | 3300028380 | Switchgrass Rhizosphere | VSAENWHEERDRLVKLLEGIESGKITHIDEKELRQLQAT |
Ga0268264_123447582 | 3300028381 | Switchgrass Rhizosphere | MEAAVSAENWHEERDRIAQLLDGIESGKITHIDEEDLRQLQATN |
Ga0247823_108503561 | 3300028590 | Soil | VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATPE |
Ga0307408_1016591111 | 3300031548 | Rhizosphere | VSAENWHEERDRLVRLLKAIETGKITHVDEEDLRELQA |
Ga0307469_117010793 | 3300031720 | Hardwood Forest Soil | VSAENWHEERDRLVELLHAIESGKVTHIDEEDLRQLQPTNPENV |
Ga0307405_116734561 | 3300031731 | Rhizosphere | VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATPENIAALKQR |
Ga0307410_102724084 | 3300031852 | Rhizosphere | VSAENWHEERDRLVQLLAGIETGKITHIDEHDLRQLQATSPENVALLKE |
Ga0307410_117232221 | 3300031852 | Rhizosphere | VSTENWHQERDRLVRLLKAIESGTVTHVDEEDLRQLQATTPEN |
Ga0307407_115363103 | 3300031903 | Rhizosphere | VRAETWHEERNRLVRLLHAIEMGDITHIDEDGLRQLQATNADNVSF |
Ga0307407_115526141 | 3300031903 | Rhizosphere | VSAENWHEERDRLVRLLEAIESGKVTHVDEEDMRQLQAT |
Ga0307412_102165621 | 3300031911 | Rhizosphere | VNTENWHEERDRLVRLLKAIESGTVTHVDEEDLRQLQAATP |
Ga0308174_117543161 | 3300031939 | Soil | VSAENWHEERDRLIRLLEAIESGKITHVDEDDLRQLQATNPHNIAR |
Ga0307409_1026128732 | 3300031995 | Rhizosphere | VSAENWHEERDRLVRLLKAIETGKVTHIDQKDLRQLQATTPENVEAL |
Ga0307416_1006171252 | 3300032002 | Rhizosphere | VSTENWTEERERLVRLLEAIEAGKITHVNEDDLRQL |
Ga0310906_101705814 | 3300032013 | Soil | VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQA |
Ga0310906_107368461 | 3300032013 | Soil | VSEENWHEERDRLVELLEAIESGTVTHIDEEDLRQLQP |
Ga0310895_104491853 | 3300032122 | Soil | VSAETWREERDRLVRLLKAIKSGKITHVDEEDLRELQATTPENIA |
Ga0310812_100338145 | 3300032421 | Soil | VSVENWHEERDRLAQLLKGIESGKITHIDEEDLRQLQ |
⦗Top⦘ |