Basic Information | |
---|---|
Family ID | F099743 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 41 residues |
Representative Sequence | LPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.17 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (68.932 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.214 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.417 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.748 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 82.52 |
PF08352 | oligo_HPY | 13.59 |
PF00496 | SBP_bac_5 | 1.94 |
PF01979 | Amidohydro_1 | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 68.93 % |
All Organisms | root | All Organisms | 31.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003218|JGI26339J46600_10024676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1727 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10345299 | Not Available | 605 | Open in IMG/M |
3300005158|Ga0066816_1009854 | Not Available | 693 | Open in IMG/M |
3300005179|Ga0066684_11038820 | Not Available | 527 | Open in IMG/M |
3300005181|Ga0066678_10070674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2043 | Open in IMG/M |
3300005345|Ga0070692_10633461 | Not Available | 712 | Open in IMG/M |
3300005347|Ga0070668_101734103 | Not Available | 574 | Open in IMG/M |
3300005455|Ga0070663_100146608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1806 | Open in IMG/M |
3300005534|Ga0070735_10224354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
3300005539|Ga0068853_101431940 | Not Available | 669 | Open in IMG/M |
3300005542|Ga0070732_10808999 | Not Available | 572 | Open in IMG/M |
3300005764|Ga0066903_107206712 | Not Available | 575 | Open in IMG/M |
3300005843|Ga0068860_101443222 | Not Available | 709 | Open in IMG/M |
3300005921|Ga0070766_10501402 | Not Available | 806 | Open in IMG/M |
3300006173|Ga0070716_100569354 | Not Available | 847 | Open in IMG/M |
3300006173|Ga0070716_101623580 | Not Available | 531 | Open in IMG/M |
3300006175|Ga0070712_100981459 | Not Available | 730 | Open in IMG/M |
3300006755|Ga0079222_12664347 | Not Available | 503 | Open in IMG/M |
3300006804|Ga0079221_11754650 | Not Available | 507 | Open in IMG/M |
3300006953|Ga0074063_10037458 | Not Available | 537 | Open in IMG/M |
3300007982|Ga0102924_1278017 | Not Available | 676 | Open in IMG/M |
3300009148|Ga0105243_10311231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1431 | Open in IMG/M |
3300009156|Ga0111538_14021955 | Not Available | 508 | Open in IMG/M |
3300009162|Ga0075423_10623750 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300009520|Ga0116214_1121729 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300009623|Ga0116133_1123729 | Not Available | 667 | Open in IMG/M |
3300009839|Ga0116223_10184458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
3300010321|Ga0134067_10127567 | Not Available | 892 | Open in IMG/M |
3300010362|Ga0126377_13122392 | Not Available | 535 | Open in IMG/M |
3300010399|Ga0134127_12548715 | Not Available | 591 | Open in IMG/M |
3300011120|Ga0150983_14042260 | Not Available | 822 | Open in IMG/M |
3300012201|Ga0137365_11135858 | Not Available | 561 | Open in IMG/M |
3300012212|Ga0150985_107801316 | Not Available | 597 | Open in IMG/M |
3300012354|Ga0137366_10788248 | Not Available | 675 | Open in IMG/M |
3300012357|Ga0137384_11371390 | Not Available | 555 | Open in IMG/M |
3300012498|Ga0157345_1011551 | Not Available | 785 | Open in IMG/M |
3300012929|Ga0137404_10219969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1618 | Open in IMG/M |
3300013296|Ga0157374_10766332 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300013306|Ga0163162_11804702 | Not Available | 699 | Open in IMG/M |
3300014745|Ga0157377_10510643 | Not Available | 842 | Open in IMG/M |
3300017933|Ga0187801_10473045 | Not Available | 528 | Open in IMG/M |
3300017943|Ga0187819_10099154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1740 | Open in IMG/M |
3300017947|Ga0187785_10705298 | Not Available | 530 | Open in IMG/M |
3300017955|Ga0187817_10105122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1779 | Open in IMG/M |
3300017959|Ga0187779_10366570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 933 | Open in IMG/M |
3300017975|Ga0187782_10520660 | Not Available | 910 | Open in IMG/M |
3300018007|Ga0187805_10390800 | Not Available | 645 | Open in IMG/M |
3300018009|Ga0187884_10451932 | Not Available | 516 | Open in IMG/M |
3300018035|Ga0187875_10418448 | Not Available | 715 | Open in IMG/M |
3300018042|Ga0187871_10053265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 2426 | Open in IMG/M |
3300018058|Ga0187766_11103100 | Not Available | 570 | Open in IMG/M |
3300020070|Ga0206356_11403161 | Not Available | 553 | Open in IMG/M |
3300020579|Ga0210407_10437944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
3300020581|Ga0210399_10537021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
3300021170|Ga0210400_11412950 | Not Available | 554 | Open in IMG/M |
3300021181|Ga0210388_10055568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 3307 | Open in IMG/M |
3300021181|Ga0210388_11759969 | Not Available | 511 | Open in IMG/M |
3300021407|Ga0210383_11693827 | Not Available | 518 | Open in IMG/M |
3300021474|Ga0210390_10673693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum → Ferrimicrobium acidiphilum DSM 19497 | 863 | Open in IMG/M |
3300021475|Ga0210392_10134348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1672 | Open in IMG/M |
3300021479|Ga0210410_11193586 | Not Available | 652 | Open in IMG/M |
3300021861|Ga0213853_10833316 | Not Available | 673 | Open in IMG/M |
3300024222|Ga0247691_1037754 | Not Available | 735 | Open in IMG/M |
3300024283|Ga0247670_1042955 | Not Available | 814 | Open in IMG/M |
3300025905|Ga0207685_10535956 | Not Available | 621 | Open in IMG/M |
3300025915|Ga0207693_10994163 | Not Available | 641 | Open in IMG/M |
3300025939|Ga0207665_10803562 | Not Available | 743 | Open in IMG/M |
3300026088|Ga0207641_11908152 | Not Available | 595 | Open in IMG/M |
3300026494|Ga0257159_1068890 | Not Available | 609 | Open in IMG/M |
3300026496|Ga0257157_1043800 | Not Available | 748 | Open in IMG/M |
3300027570|Ga0208043_1007070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 3861 | Open in IMG/M |
3300027889|Ga0209380_10037183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2755 | Open in IMG/M |
3300027898|Ga0209067_10683985 | Not Available | 594 | Open in IMG/M |
3300028906|Ga0308309_11666852 | Not Available | 542 | Open in IMG/M |
3300028906|Ga0308309_11721294 | Not Available | 532 | Open in IMG/M |
3300029999|Ga0311339_10810098 | Not Available | 900 | Open in IMG/M |
3300029999|Ga0311339_10934699 | Not Available | 819 | Open in IMG/M |
3300030580|Ga0311355_10534279 | Not Available | 1118 | Open in IMG/M |
3300030707|Ga0310038_10496924 | Not Available | 516 | Open in IMG/M |
3300031090|Ga0265760_10288576 | Not Available | 579 | Open in IMG/M |
3300031198|Ga0307500_10048849 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300031421|Ga0308194_10042245 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300031543|Ga0318516_10075412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1876 | Open in IMG/M |
3300031543|Ga0318516_10533520 | Not Available | 672 | Open in IMG/M |
3300031564|Ga0318573_10234576 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300031668|Ga0318542_10438673 | Not Available | 676 | Open in IMG/M |
3300031682|Ga0318560_10299708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. Ac-20353 | 866 | Open in IMG/M |
3300031713|Ga0318496_10808300 | Not Available | 516 | Open in IMG/M |
3300031724|Ga0318500_10100474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. Ac-20353 | 1315 | Open in IMG/M |
3300031754|Ga0307475_11149127 | Not Available | 606 | Open in IMG/M |
3300031782|Ga0318552_10592990 | Not Available | 565 | Open in IMG/M |
3300031860|Ga0318495_10228466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. Ac-20353 | 835 | Open in IMG/M |
3300031910|Ga0306923_10973881 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300031912|Ga0306921_11723651 | Not Available | 676 | Open in IMG/M |
3300031943|Ga0310885_10089625 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300031945|Ga0310913_10159704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
3300032054|Ga0318570_10587364 | Not Available | 508 | Open in IMG/M |
3300032089|Ga0318525_10500813 | Not Available | 622 | Open in IMG/M |
3300032770|Ga0335085_10103238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 3681 | Open in IMG/M |
3300032954|Ga0335083_11365129 | Not Available | 543 | Open in IMG/M |
3300033289|Ga0310914_11736545 | Not Available | 528 | Open in IMG/M |
3300033290|Ga0318519_10503984 | Not Available | 729 | Open in IMG/M |
3300034065|Ga0334827_126080 | Not Available | 818 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.97% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.97% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.97% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26339J46600_100246761 | 3300003218 | Bog Forest Soil | IAGRWLRPADPTPVLAEVSQRRGKVAGFLHLFSRSSLLDETEGGRP* |
JGIcombinedJ51221_103452991 | 3300003505 | Forest Soil | SRIAGRWLKPADPTPVLSEISQRRTGFAGFLHSFSRSSLLDKAEAGERP* |
Ga0066816_10098542 | 3300005158 | Soil | ANPTPVLSDVPQRRGRLAGFLHSFSRSSLLDDTEGGRAR* |
Ga0066684_110388201 | 3300005179 | Soil | RPADPTPVLSDISQRRRGLSGFLHSFSRSSLLDETEGGRTR* |
Ga0066678_100706741 | 3300005181 | Soil | GHWLPPADPTPVLSDASQRRGRLAGFLHSFSRSSLVDETKGGDAR* |
Ga0070692_106334611 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ANPTPVLGDVSQHRGRVASFLHSFSRSSLIDETKVGDAR* |
Ga0070668_1017341032 | 3300005347 | Switchgrass Rhizosphere | PANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAQ* |
Ga0070663_1001466081 | 3300005455 | Corn Rhizosphere | PPANPTPVLGDVSQHRGRVASFLHSFSRSSLIDETKVGDAR* |
Ga0070735_102243541 | 3300005534 | Surface Soil | GHWLRPADPTPVLSEISQRRKGLAGFLHSFSRRSLLEGAEAGERR* |
Ga0068853_1014319402 | 3300005539 | Corn Rhizosphere | ANPTPVLGDVSQHRGRVASFLHSFSRSSLIDETKGGDAR* |
Ga0070732_108089991 | 3300005542 | Surface Soil | WLRPTDPTPVLQEVLQRRTGVGGFLHSFSRSSLLDESRAGDTL* |
Ga0066903_1072067122 | 3300005764 | Tropical Forest Soil | PVLSDVSQRRGRVAGFLHSFSRSSLIDETKRGDAR* |
Ga0068860_1014432221 | 3300005843 | Switchgrass Rhizosphere | AGRWLPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAQ* |
Ga0070766_105014021 | 3300005921 | Soil | PVLSEISQRRNGFAGFLHSFSRSSLVDKAEAGERP* |
Ga0070716_1005693541 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAR* |
Ga0070716_1016235801 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGQAR* |
Ga0070712_1009814591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ADPTPVLGEIGQRRGRVSGFLHSFSRSSLLDENEGGRAR* |
Ga0079222_126643472 | 3300006755 | Agricultural Soil | RWLPPANPTPVLGDVSQRRGRVAGFLHSFSRSSLIDETKGGDAR* |
Ga0079221_117546503 | 3300006804 | Agricultural Soil | RWLPPANPTPVLGDVSRGRGRLAGFLHSFSRSSLLDETEGEQAR* |
Ga0074063_100374582 | 3300006953 | Soil | RIAGRWLPPANPTPVLGDVSRRRGRLAGFLHSFSRSSLLDDTEGGRAR* |
Ga0102924_12780172 | 3300007982 | Iron-Sulfur Acid Spring | PVLSEISQRRKGLAGFLHSFSRSSLLDGADAGERR* |
Ga0105243_103112313 | 3300009148 | Miscanthus Rhizosphere | VLSDASQRRGRLAGFLHSFSRSSLVDETKGGDAR* |
Ga0111538_140219552 | 3300009156 | Populus Rhizosphere | VLGDVSRGRGRLAGFLHSFSRSSLHDETEGGQAR* |
Ga0075423_106237502 | 3300009162 | Populus Rhizosphere | LPPANPTPVLGDVSQRRGRVAGFLHSFSRSSLIDETKGGDAR* |
Ga0116214_11217291 | 3300009520 | Peatlands Soil | GRWLRPTDPTPVLAQVQQRRTGLAGFLHSFSRSSLLDRTEAGDTL* |
Ga0116133_11237291 | 3300009623 | Peatland | PTPVLAEVVQHRGKLAGFLHSFSRSSLLDETERAGHR* |
Ga0116223_101844581 | 3300009839 | Peatlands Soil | ADPTPVLSEISQRRHGFAGFLHSFSRRSLLDQAEAGERR* |
Ga0134067_101275671 | 3300010321 | Grasslands Soil | TPVLSDASQRRGRLAGFLHSFSRSSLLDETEGGKAR* |
Ga0126377_131223921 | 3300010362 | Tropical Forest Soil | AGRWLKPADPTPVLSDISQRRGRVAGFLHSFSRSSLLDETKGGDAR* |
Ga0134127_125487151 | 3300010399 | Terrestrial Soil | PANPTPVLGDVSQGRGRLAGFLHSFSRSSLIDETKGGDAR* |
Ga0150983_140422601 | 3300011120 | Forest Soil | DPTPVLSDASQRRGRLAGFLHSFSRSSLVDETKGGDAR* |
Ga0137365_111358582 | 3300012201 | Vadose Zone Soil | VLSDISQRRGRLGGFLHSFSRSSLLDETEGGRAR* |
Ga0150985_1078013162 | 3300012212 | Avena Fatua Rhizosphere | SPRSAGRWLRPADPTPVLGEIANQRGRVAGFLHSFSRSSLLDDTEGSRAR* |
Ga0137366_107882481 | 3300012354 | Vadose Zone Soil | PVLAEVAQRRGKLAGFLHSFSRSSLLDETEGGQAR* |
Ga0137384_113713901 | 3300012357 | Vadose Zone Soil | PTPVLSDVSQRRGRLAGFLHSFSRSSLLDDTEGGRAR* |
Ga0157345_10115512 | 3300012498 | Arabidopsis Rhizosphere | GRWLPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRTR* |
Ga0137404_102199693 | 3300012929 | Vadose Zone Soil | PADPTPVLSDGAQHRGRVAGFLHSFSRSSLLDETEGGRAR* |
Ga0157374_107663321 | 3300013296 | Miscanthus Rhizosphere | TPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAQ* |
Ga0163162_118047021 | 3300013306 | Switchgrass Rhizosphere | PTPVLGDVSQHRGRVAGFLHSFSRSSLIDETKGGDAR* |
Ga0157377_105106431 | 3300014745 | Miscanthus Rhizosphere | TPVLGDVSQRRGKVAGFLHSFSRSSLLDETEGGQTR* |
Ga0187801_104730452 | 3300017933 | Freshwater Sediment | ADPTPVLADITQHRRGLAGFLHSFSRSSLLDKGEAGVDL |
Ga0187819_100991541 | 3300017943 | Freshwater Sediment | NPTPVLAEVSQHRGRVATFLNSFSRSSLLDEAGAGES |
Ga0187785_107052982 | 3300017947 | Tropical Peatland | AGRWLRPADPTPVLSDVSQRRGRVAGFLHSFSRSSLIDETKRGDAR |
Ga0187817_101051223 | 3300017955 | Freshwater Sediment | IAGHWLRPTDPTPVLEQVQQRRTGLAGFLHSFSRSSLLDRTEAGDTL |
Ga0187779_103665702 | 3300017959 | Tropical Peatland | IAGRWLKPADPTPVLAEISQRRSGFAGFLHSFSRSSLLDKGEAGEGR |
Ga0187782_105206602 | 3300017975 | Tropical Peatland | PADPTPVLAEVSQRRGPIARFLRSFSRSSLLDETAGGER |
Ga0187805_103908001 | 3300018007 | Freshwater Sediment | SRIAGHWLPPANPTPVLAEVSQHRGRVATFLNSFSRSSLLDEAGAGES |
Ga0187884_104519321 | 3300018009 | Peatland | RIAGHWLRPADPTPVLAELSRHRGKLAGFVHSFSRSSQLDETEGGQAR |
Ga0187875_104184482 | 3300018035 | Peatland | WLPPADPTPVLAEVVQHRGKLSGFLRSFSRSSLLDDAEKGGHR |
Ga0187871_100532653 | 3300018042 | Peatland | LPPADPTPVLAEVAQHRGKLAGFLHSFSRSSLLDETERAGHR |
Ga0187766_111031001 | 3300018058 | Tropical Peatland | AGRWLRPANPTPVLGELSQGRGRLSRFWHSFSRSSLLDEHQGGQR |
Ga0206356_114031612 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | WLPPANPTPVLGDVSQRRGRLAGFLHSFSRSSLLDETEGGRAQ |
Ga0210407_104379441 | 3300020579 | Soil | PVLSEVSYRRKGLASFLHSFSRSSLLDNAEAGEGR |
Ga0210399_105370212 | 3300020581 | Soil | GRWLRPADPTPVLSEISQRRNGFAGFLHSFSRSSLLDNAEAGEGR |
Ga0210400_114129502 | 3300021170 | Soil | PVLSEISQRRNGLAGFLHSFSRSSLLDKAEAGEGR |
Ga0210388_100555685 | 3300021181 | Soil | DPTPVLAEVSQRRGTLARFAHSFSRSSLLDETEGGKS |
Ga0210388_117599691 | 3300021181 | Soil | IAGRCLKPADPTPVLSEISQRRHGFLHSFSRSSLLDQAEAGEGR |
Ga0210383_116938271 | 3300021407 | Soil | PADPTPVLGEDPPRRGLAGFLHSFSRSSLLSDDQPGGRR |
Ga0210390_106736932 | 3300021474 | Soil | PTPVLGEVPPRRGLAGFLHSFSRSSLLSDDQPGGRR |
Ga0210392_101343481 | 3300021475 | Soil | CRRWLPPANPTPVLGDVARRRGRLAGFLHSFSRSSLLDETEGGRAR |
Ga0210410_111935862 | 3300021479 | Soil | RWLRPADPTPVLSEVSQRRNGFAGFLHSFSRSSLLDQAEAGEGR |
Ga0213853_108333161 | 3300021861 | Watersheds | GYWLPPADPTPVLADVSQHRGKLAGFLHSFSRGSLLDETEGGQAR |
Ga0247691_10377541 | 3300024222 | Soil | WLPPANPTPVLGDVSRRRGRLAGFLHSFSRSSLLDETEGGRADDR |
Ga0247670_10429551 | 3300024283 | Soil | RIAGRWLPPANPTPVLSDVSQRRGRLAGFLHSFSRSSLLDETEGGRAR |
Ga0207685_105359562 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AGHWLPPADPTPVLSDASQRRGRLAGFLHSFSRSSLVDETKGGDAR |
Ga0207693_109941632 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AGHWLPPADPTPVLSDASQRRGRLAGFLHSFSRSSLVDETKGRDAR |
Ga0207665_108035622 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LRPADPTPVLGEVSQRGRLGGFLHSFSRSSLLDETDRSQAR |
Ga0207641_119081521 | 3300026088 | Switchgrass Rhizosphere | AGRWLPPANPTPVLGDVSQHRGRVASFLHSFSRSSLIDETKGGDAR |
Ga0257159_10688902 | 3300026494 | Soil | RPADPTPVLSDVSQHRGRVAGFLHSFSRSSLVDETKGGDAR |
Ga0257157_10438002 | 3300026496 | Soil | GRWLRPADPTPVLSEISQRRNGLAGFLHSFSRSSLLDNAEAGERR |
Ga0208043_10070701 | 3300027570 | Peatlands Soil | PADPTPVLAEVSQQRGKVSGFLHSFSRSSLLDETEGGKP |
Ga0209380_100371831 | 3300027889 | Soil | TPVLAEVSQRRSALARFVHSFSRSSLLDETEGGKS |
Ga0209067_106839852 | 3300027898 | Watersheds | IAGRWLRPADPTPVLAEVSQRRGKVTGFLHSFSRSSLLDETEGGKP |
Ga0308309_116668522 | 3300028906 | Soil | LPPADPTPVLAEVAQYRGKLSAFLHSFSRSSLLDETERAGHR |
Ga0308309_117212942 | 3300028906 | Soil | DPTPVLAEVSQRRSALARFVHSFSRSSLLDETEGGKS |
Ga0311339_108100981 | 3300029999 | Palsa | AGRWLPPAGPTPVLAEVGRDRGRLAGFVHSFSRSSLLDETERRSAR |
Ga0311339_109346992 | 3300029999 | Palsa | AGHWLPPADPTPVLAEVAQYRGKLSGFLHSFSRSSLLDETERAGHR |
Ga0311355_105342791 | 3300030580 | Palsa | TPVLAEVGRDRGRLAGFVHSFSRSSLLDETERRSAR |
Ga0310038_104969241 | 3300030707 | Peatlands Soil | WLRPADPTPVLSEISQRRNGFAGFLHSFSRSSLLDKAEAGERR |
Ga0265760_102885761 | 3300031090 | Soil | GRWLRPADPTPVLAEVSQQRGTLARFAHSFSRSSLLDETEGGKP |
Ga0307500_100488492 | 3300031198 | Soil | NPTPVLGDVSRRRGRLAGFLHSFSRSSLLDETEGGRADDR |
Ga0308194_100422451 | 3300031421 | Soil | PTPVLGDVSRRRGRLAGFLHSFSRSSLLDETEGGRVR |
Ga0318516_100754121 | 3300031543 | Soil | LRPADPTPVLADISRRRSGLAGFLHAFSRSSLVDGAEAGDPR |
Ga0318516_105335202 | 3300031543 | Soil | PADPTPVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0318573_102345761 | 3300031564 | Soil | PVLSEISQRRNGFAGFLHSFSRSSLLDKGEAGERR |
Ga0318542_104386732 | 3300031668 | Soil | GHWLKPADPTPVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0318560_102997082 | 3300031682 | Soil | KPADPTPVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0318496_108083001 | 3300031713 | Soil | PVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0318500_101004742 | 3300031724 | Soil | GRWLRPADPTPVLSDVSQRRGRVAGFLHSFSRSSLVDENKRGDAR |
Ga0307475_111491272 | 3300031754 | Hardwood Forest Soil | HWLKPADPTPVLAEISQHRGGLAGFLHSFSRSSLLDKGEAGVNR |
Ga0318552_105929902 | 3300031782 | Soil | IAGRWLRPADPTPVLSDVSQRRGRVAGFLHSFSRSSLIDETKRGDAR |
Ga0318495_102284662 | 3300031860 | Soil | PTPVLSDVSQRRGRVAGFLHSFSRSSLVDENKRGDAR |
Ga0306923_109738812 | 3300031910 | Soil | ADPTPVLADISQHRGWFAGFLHSFSRSSLLDKGEAGEA |
Ga0306921_117236511 | 3300031912 | Soil | AGHWLKPADPTPVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0310885_100896253 | 3300031943 | Soil | NPTPVLGDVSQHRGRVAGFLHSFSRSSLIDETKGGDAR |
Ga0310913_101597041 | 3300031945 | Soil | IAGRWLRPADPTPVLGDVSQRRGRLAGFLHSFSRSSLIDETKRGDAR |
Ga0318570_105873642 | 3300032054 | Soil | PTPVLSEISQRRNGFAGFLHSFSRSSLLDKGEAGERR |
Ga0318525_105008131 | 3300032089 | Soil | DPTPVLSDISQRRGRVAGFLHSFSRSSLIDETKAGDAR |
Ga0335085_101032381 | 3300032770 | Soil | PTPVLSDISQRRGRVAGFLHSFSRSSLLDETEGGRAR |
Ga0335083_113651291 | 3300032954 | Soil | RWLRPADPTPVFGEAGQRGRLGSFLHSFSRSSLLDETERSQAR |
Ga0310914_117365451 | 3300033289 | Soil | RWLRPADPTPVLSEISQRRSGFAGFLHSFSRSSLLDKAEAGERR |
Ga0318519_105039842 | 3300033290 | Soil | PTPVLSDVSQHRGKLAGFLHSFSRSSLIDETKRGDAR |
Ga0334827_126080_679_816 | 3300034065 | Soil | GHWLRPADPTPVLAEVLQHRGKLAGFVHSFSRNSLLDETEGGQLR |
⦗Top⦘ |