NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099905

Metagenome / Metatranscriptome Family F099905

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099905
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 44 residues
Representative Sequence EQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR
Number of Associated Samples 89
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.26 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.786 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.155 % of family members)
Environment Ontology (ENVO) Unclassified
(31.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.544 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.43%    β-sheet: 0.00%    Coil/Unstructured: 58.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01063Aminotran_4 5.83
PF00916Sulfate_transp 4.85
PF00903Glyoxalase 3.88
PF13377Peripla_BP_3 3.88
PF01614IclR 2.91
PF02687FtsX 2.91
PF01717Meth_synt_2 1.94
PF13407Peripla_BP_4 1.94
PF08044DUF1707 1.94
PF10604Polyketide_cyc2 1.94
PF03807F420_oxidored 1.94
PF08223PaaX_C 0.97
PF00196GerE 0.97
PF09278MerR-DNA-bind 0.97
PF07704PSK_trans_fac 0.97
PF12902Ferritin-like 0.97
PF00578AhpC-TSA 0.97
PF08818DUF1801 0.97
PF02628COX15-CtaA 0.97
PF13515FUSC_2 0.97
PF00005ABC_tran 0.97
PF03243MerB 0.97
PF00296Bac_luciferase 0.97
PF11706zf-CGNR 0.97
PF08240ADH_N 0.97
PF12697Abhydrolase_6 0.97
PF07690MFS_1 0.97
PF00884Sulfatase 0.97
PF00126HTH_1 0.97
PF00085Thioredoxin 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 11.65
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 4.85
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 4.85
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 4.85
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 2.91
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.94
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.97
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.97
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.97
COG3327DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation)Transcription [K] 0.97
COG4423Uncharacterized conserved proteinFunction unknown [S] 0.97
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.97
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.97
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.79 %
UnclassifiedrootN/A26.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12562519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300004082|Ga0062384_100106178All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300004091|Ga0062387_100535196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11826Open in IMG/M
3300004091|Ga0062387_101229794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300004635|Ga0062388_100963147All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005332|Ga0066388_101898182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1063Open in IMG/M
3300005434|Ga0070709_11599623Not Available531Open in IMG/M
3300005437|Ga0070710_10274535Not Available1091Open in IMG/M
3300005468|Ga0070707_100050751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3977Open in IMG/M
3300005591|Ga0070761_10812341Not Available589Open in IMG/M
3300005842|Ga0068858_100504178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1169Open in IMG/M
3300006163|Ga0070715_10760094Not Available585Open in IMG/M
3300006163|Ga0070715_11098959Not Available501Open in IMG/M
3300006174|Ga0075014_100773889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300006174|Ga0075014_100920702Not Available525Open in IMG/M
3300006581|Ga0074048_12619544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300006755|Ga0079222_10056906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1850Open in IMG/M
3300006806|Ga0079220_10475015Not Available845Open in IMG/M
3300006806|Ga0079220_10589169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium787Open in IMG/M
3300006954|Ga0079219_12014013Not Available550Open in IMG/M
3300009098|Ga0105245_10867213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium943Open in IMG/M
3300009101|Ga0105247_11841596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300009525|Ga0116220_10256168Not Available765Open in IMG/M
3300009839|Ga0116223_10387888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300010358|Ga0126370_10669141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia907Open in IMG/M
3300010371|Ga0134125_11359567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300010373|Ga0134128_11614224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300010379|Ga0136449_102289173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium784Open in IMG/M
3300010862|Ga0126348_1080915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300012176|Ga0153952_1079439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300012477|Ga0157336_1006112Not Available816Open in IMG/M
3300012989|Ga0164305_10204473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1391Open in IMG/M
3300013306|Ga0163162_11114542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium894Open in IMG/M
3300015373|Ga0132257_100521781Not Available1459Open in IMG/M
3300015374|Ga0132255_101794958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300016294|Ga0182041_10054579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2726Open in IMG/M
3300016319|Ga0182033_10246608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1449Open in IMG/M
3300016357|Ga0182032_11857004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300016387|Ga0182040_10519655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia954Open in IMG/M
3300016404|Ga0182037_11299435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium641Open in IMG/M
3300016422|Ga0182039_12264200Not Available502Open in IMG/M
3300017928|Ga0187806_1045338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris1328Open in IMG/M
3300017939|Ga0187775_10541880Not Available500Open in IMG/M
3300017942|Ga0187808_10425292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300017942|Ga0187808_10502279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300017973|Ga0187780_10914463Not Available637Open in IMG/M
3300017974|Ga0187777_10527985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300017974|Ga0187777_10906334All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300017974|Ga0187777_11191447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium557Open in IMG/M
3300018085|Ga0187772_10524306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium837Open in IMG/M
3300018088|Ga0187771_11753813All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300019890|Ga0193728_1214238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300021088|Ga0210404_10677138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300021170|Ga0210400_10984836Not Available686Open in IMG/M
3300021171|Ga0210405_10619830Not Available841Open in IMG/M
3300021178|Ga0210408_10643773Not Available837Open in IMG/M
3300021404|Ga0210389_10806124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300021474|Ga0210390_10515595Not Available1006Open in IMG/M
3300021474|Ga0210390_11363056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300025927|Ga0207687_10095774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2174Open in IMG/M
3300025929|Ga0207664_11993371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300026035|Ga0207703_11081843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300027775|Ga0209177_10405996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300027829|Ga0209773_10085824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1293Open in IMG/M
3300028875|Ga0307289_10027573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2222Open in IMG/M
3300028885|Ga0307304_10067287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1367Open in IMG/M
3300030743|Ga0265461_11079243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300031199|Ga0307495_10172418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae576Open in IMG/M
3300031543|Ga0318516_10706551All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031543|Ga0318516_10844267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300031544|Ga0318534_10124246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1483Open in IMG/M
3300031544|Ga0318534_10560391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300031546|Ga0318538_10128575Not Available1328Open in IMG/M
3300031561|Ga0318528_10702138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium541Open in IMG/M
3300031680|Ga0318574_10057658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2061Open in IMG/M
3300031680|Ga0318574_10841390Not Available537Open in IMG/M
3300031718|Ga0307474_10008872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7255Open in IMG/M
3300031736|Ga0318501_10603244All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031748|Ga0318492_10208818Not Available1001Open in IMG/M
3300031751|Ga0318494_10104235All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300031764|Ga0318535_10212267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium866Open in IMG/M
3300031771|Ga0318546_10750966Not Available687Open in IMG/M
3300031779|Ga0318566_10184214All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300031779|Ga0318566_10540025Not Available570Open in IMG/M
3300031796|Ga0318576_10431926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300031823|Ga0307478_10337301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300031890|Ga0306925_11171028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300031894|Ga0318522_10311814Not Available596Open in IMG/M
3300031912|Ga0306921_10931642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300031942|Ga0310916_10488695All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300031954|Ga0306926_12243456Not Available607Open in IMG/M
3300032008|Ga0318562_10444583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M
3300032074|Ga0308173_12354978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300032076|Ga0306924_12203822Not Available562Open in IMG/M
3300032089|Ga0318525_10089538All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300032089|Ga0318525_10384986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300032261|Ga0306920_100416188All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300032515|Ga0348332_13923331All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium647Open in IMG/M
3300032828|Ga0335080_10177615All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2349Open in IMG/M
3300032828|Ga0335080_11308535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300032897|Ga0335071_10072373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3382Open in IMG/M
3300032898|Ga0335072_10645763Not Available1051Open in IMG/M
3300033134|Ga0335073_10188945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2569Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.97%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.97%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012176Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaGHost-AssociatedOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1256251913300000789SoilRELRTEEQEALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0062384_10010617833300004082Bog Forest SoilYPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQLYVTEPDVNR*
Ga0062387_10053519623300004091Bog Forest SoilKLYPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQLYVTEPDVNR*
Ga0062387_10122979413300004091Bog Forest SoilKLYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYERYVIEPDVNR*
Ga0062388_10096314723300004635Bog Forest SoilQAALDFCEFQLGTVHDLMEPPGSPELEEAYKRYVSEPDVSR*
Ga0066388_10189818223300005332Tropical Forest SoilHHKLHPKQQEALDFCEFQLRTVRNYMEPPGSPELEEAYKRYVTELDVSR*
Ga0070709_1159962313300005434Corn, Switchgrass And Miscanthus RhizosphereRLRELRTEEQDALDFCGFQLRTIGTYMEPPGSPELEKAYQRYISEPDVNR*
Ga0070710_1027453513300005437Corn, Switchgrass And Miscanthus RhizosphereEQEALDFCEFQLGTIRDYMEPPGSPGLEEAYKLYVSEPDVNRCS*
Ga0070707_10005075113300005468Corn, Switchgrass And Miscanthus RhizosphereLGTEEQEALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0070761_1081234113300005591SoilLDFCAFQLGTVRDYMEPPGSAELEEAYRRYVHEPDVNR*
Ga0068858_10050417813300005842Switchgrass RhizosphereELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0070715_1076009423300006163Corn, Switchgrass And Miscanthus RhizosphereLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0070715_1109895913300006163Corn, Switchgrass And Miscanthus RhizosphereALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0075014_10077388923300006174WatershedsMNAPPELSAEEQAALDFCEFQLGTVRAYMESPGSAELEEAYQRY
Ga0075014_10092070213300006174WatershedsCTEEQAALEFCEFQLTTIRDYMEPPGSPELEDAYQQYVGEPDVNR*
Ga0074048_1261954433300006581SoilRTEEQEALAFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0079222_1005690613300006755Agricultural SoilQEALDFCQFQLGTVHDYMEPPGSPELDEACKRYVSEPDVSR*
Ga0079220_1047501533300006806Agricultural SoilLHARQQEALDFCQFQLGTVHDYMEPPGSPELDEACKRYVSEPDVSR*
Ga0079220_1058916913300006806Agricultural SoilQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0079219_1201401323300006954Agricultural SoilLDFCQFQLGTIRDYMEPPGSPELKEAYQRYVSDPDVNR*
Ga0105245_1086721313300009098Miscanthus RhizosphereELRTEEREALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0105247_1184159623300009101Switchgrass RhizosphereEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0116220_1025616833300009525Peatlands SoilCEFQLTTIRDYMEPPGSPELEEAYQRYVSEPDVNR*
Ga0116223_1038788813300009839Peatlands SoilLDFCEFQLGTVHNYMEPPGSPELEEAYRRYVSEPDVNR*
Ga0126370_1066914113300010358Tropical Forest SoilCTFQLGTVRDYMEPPGSPELDEAYERYVSEPDVSR*
Ga0134125_1135956713300010371Terrestrial SoilDMAHRAVLQSRLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0134128_1161422413300010373Terrestrial SoilEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0136449_10228917323300010379Peatlands SoilLYPAEREALDFCGFQLETIRDYMEPPGSPELEEAYKRCVSEPDVNR*
Ga0126348_108091513300010862Boreal Forest SoilCEFQLGTIRDYMEPPGSPELEEAYKLYVRQPDVNR*
Ga0153952_107943913300012176Attine Ant Fungus GardensEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR*
Ga0157336_100611213300012477Arabidopsis RhizosphereLAILQSHLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0164305_1020447313300012989SoilLRTEEQEALDFCGFQLRTIGAYMDPPGSPELEKAYQRYISEPDVNR*
Ga0163162_1111454213300013306Switchgrass RhizosphereSHLRELRTEERDALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0132257_10052178143300015373Arabidopsis RhizosphereRTEEQEALDFCGFQLRTIGPYMEPPSSPELEKAYQRYISEPDVNR*
Ga0132255_10179495813300015374Arabidopsis RhizosphereLDFCRFQLRTTGAYMEPPGSPELEKAYQRYISEPDVNR*
Ga0182041_1005457963300016294SoilSAGEQEALDFCAFQLGTIRDYMEPPGSAELEEAYQRYVRDPDVNR
Ga0182033_1024660813300016319SoilKLRPSEQEALDFCDFQLGTIRDYMERPGSPELEEAYVRYVSEPDVSR
Ga0182032_1185700423300016357SoilCTFQLGTVRDYMEPPGSAELEEAYQRYVRDPDVNR
Ga0182040_1051965513300016387SoilREREALDFCAFQLGTVHDYMEPPGSPGLEEAYQRYVSEPDVNR
Ga0182037_1129943523300016404SoilRKLQAGQQEALEFCEFQLGTVHDYMEPPGSPELEGAYQRYVSGPDVDR
Ga0182039_1226420023300016422SoilGAAQQLHRRELRADEQAALDFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR
Ga0187806_104533813300017928Freshwater SedimentQEALDFCEFQLGTVRHYMEPPGSPELEEAYPRYVSEPDVNR
Ga0187775_1054188013300017939Tropical PeatlandQKRAEEQAALDFCGFQLGTVHDYMEPPGSPELEEAYRRYVSEPDVSR
Ga0187808_1042529213300017942Freshwater SedimentLDFCEFQLGTVHDYMEPPGSPELEEAYRRYVSEPDVNR
Ga0187808_1050227923300017942Freshwater SedimentEQEALDFCEFQLGTVRDYMEPPGSPELEEAYELYVTEPDVNR
Ga0187780_1091446313300017973Tropical PeatlandFCEFQLGTVHDYMEPPGSPELEEAYQRYVSDPDVNR
Ga0187777_1052798513300017974Tropical PeatlandLHARQTEALDFCEFQLGTVHDYKEPPGSPELEEAYRRYVSEPDASR
Ga0187777_1090633413300017974Tropical PeatlandLRAEEREALDFCDFQLGTVRDYMEPPGSPELEEAYQRHVSGPDVDR
Ga0187777_1119144723300017974Tropical PeatlandALDYCDFQLSTVRAYMEPPGSPALEGASRRYVTEPDVNR
Ga0187772_1052430613300018085Tropical PeatlandHRHGREPSAEEQAALDFCDFQLSTVQDYMEPPGSPELERAYRRYVAEPDVNR
Ga0187771_1175381313300018088Tropical PeatlandRHLHCRTLRTEEQAALDFCEFQLSTVHDYMEPPGSPELEEAYRRYVSEPDVNR
Ga0193728_121423833300019890SoilMAHRAILQSHLRELRTEEQEALDFCRFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0210404_1067713823300021088SoilSHLRELGTEEQQALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0210400_1098483623300021170SoilGRVLYPAEQEALDFCECQLETIRDYMEPPGSPELEEAYKLYVSEPDVNR
Ga0210405_1061983023300021171SoilPDGRELYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYKLYVSTPDVNR
Ga0210408_1064377313300021178SoilELYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYKLYVSEPDVNR
Ga0210389_1080612423300021404SoilDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0210390_1051559513300021474SoilLEFCAFQLKTIRDYMEPPGSPELEEAHRRYVSEPDVNR
Ga0210390_1136305613300021474SoilRRELCTQEQAALEFCEFQLRTMRDYMEPPGSPELEEAYQRYVSGPDVNR
Ga0207687_1009577443300025927Miscanthus RhizosphereRTEERDALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0207664_1199337113300025929Agricultural SoilELRTEEQEALDFCGFQLRTIGAYMEPPGSPDLEKAYQRYISEPDVNR
Ga0207703_1108184323300026035Switchgrass RhizosphereRLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0209177_1040599613300027775Agricultural SoilLRTEEQEALDFCRFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0209773_1008582433300027829Bog Forest SoilALDFCEFQLGTIRDYMEPPGSPELEEAYKLYVSGPDVNR
Ga0307289_1002757343300028875SoilSHLRELRTEEREALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0307304_1006728713300028885SoilALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0265461_1107924333300030743SoilTEKQAALEFCTFQLKTIRDYMEPPGSPELEEAHRRYVSEPDVNR
Ga0307495_1017241813300031199SoilFCAFQLGTVRDYMEAPGSAELEEAYQRYVHEPDVNR
Ga0318516_1070655113300031543SoilLRAEEREALDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR
Ga0318516_1084426723300031543SoilLDFCAFQLGTVHHYMEPPGSPELAEAYQRYVSDPDVNR
Ga0318534_1012424613300031544SoilFCEFQLGTIRNYMEPPGSPELEEAYVRFVREPDVNR
Ga0318534_1056039123300031544SoilEREALDFCAFQLGTVHDYMEPPGSPELEEAYQRYVSEPDVNR
Ga0318538_1012857533300031546SoilRGAAQQLHRRELRADEQAALDFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR
Ga0318528_1070213823300031561SoilRELRAEEREALDFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR
Ga0318574_1005765833300031680SoilSEQEALDFCEFQLGTIRNYMEPPGSPELEEAYVRFVREPDVNR
Ga0318574_1084139013300031680SoilDFCEFQLGTIRDYMEPPGSPELEEAYSRYVSEPDVNR
Ga0307474_10008872123300031718Hardwood Forest SoilPAEQEALDFCEFQLGTIRDYMEAPGSPELEEAYKRYISNPDVNR
Ga0318501_1060324413300031736SoilLDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR
Ga0318492_1020881833300031748SoilALDFCEFQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR
Ga0318494_1010423563300031751SoilLVCFLQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR
Ga0318535_1021226723300031764SoilRQLHRRELRAEEREALGFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR
Ga0318546_1075096623300031771SoilFCKFQLGTIRDYMEPPGSAGLKEAYQRYVSDPDVNR
Ga0318566_1018421413300031779SoilDFCEFQLGTIRNYMEPPGSPELEEAYARFVSEPDVNR
Ga0318566_1054002513300031779SoilEALEFCEFQLGTVRDYMEPPGSPELEEAYVRYVSEPDVNR
Ga0318576_1043192613300031796SoilTLHAREQEALDFCTFQLGTVRDYMEPPGSAELEEAYQRYVRDPDVNR
Ga0307478_1033730113300031823Hardwood Forest SoilYPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR
Ga0306925_1117102813300031890SoilPREQEALDFCKFQLGTIRDYMEPPGSAELEEAYQRYVRDPDVNR
Ga0318522_1031181413300031894SoilDFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR
Ga0306921_1093164213300031912SoilFCEFQLGTVRDYMEPPGSPELEEAYVRYVSEPDVNR
Ga0310916_1048869533300031942SoilLHRGELRAEEREALDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR
Ga0306926_1224345613300031954SoilDFCEFQLGTIRDYMEPPGSPELEEAYVRSVGEPDVNR
Ga0318562_1044458323300032008SoilLHAGQQEALDFCESQLGTVHDYMEPPGSPELEEAHKRYVWEPDVNRFCDPA
Ga0308173_1235497813300032074SoilVAHRAVLQSRLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR
Ga0306924_1220382223300032076SoilCAYQLGTIRDYMEPPGSAELEEAYQRYVSDPDVNR
Ga0318525_1008953813300032089SoilPRHQEALDFCEFQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR
Ga0318525_1038498623300032089SoilREREALDFCAFQLGTVHDYMEPPGSPELEEAYQRYVSEPDVNR
Ga0306920_10041618843300032261SoilDQARQAVWQLHRRELRAEEREALGFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR
Ga0348332_1392333123300032515Plant LitterWTLYPAEQEALDFCEFQLGTIREYMEPPGSPELEEAYKLYVSEPDVNR
Ga0335080_1017761523300032828SoilEALDFCKFQLGTIRDYMEPPGSAELKEAYQRYVSDPDVNR
Ga0335080_1130853513300032828SoilRAREQEALDFCEFQLGTIRDYMEPPGSPELKEAYQRYVTDPDVNR
Ga0335071_1007237343300032897SoilHRRTLHASEQEALDFCTFQLQTVRDYMEPPGSAELEEAYKRYVRDPDVNR
Ga0335072_1064576313300032898SoilLDFCGFQLRTIGAYMEPPGSPELEKAYERYISEPDVNR
Ga0335073_1018894533300033134SoilRELYTEEEEAADFCEFQLRTIGAYMEPPGSPELEKAYERYISEPDVNR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.