NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099997

Metagenome Family F099997

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099997
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 68 residues
Representative Sequence MDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Number of Associated Samples 83
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.88 %
% of genes near scaffold ends (potentially truncated) 30.10 %
% of genes from short scaffolds (< 2000 bps) 69.90 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.612 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.155 % of family members)
Environment Ontology (ENVO) Unclassified
(88.350 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.204 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 60.29%    Coil/Unstructured: 39.71%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13539Peptidase_M15_4 18.45
PF16778Phage_tail_APC 2.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.06 %
UnclassifiedrootN/A1.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10006454All Organisms → cellular organisms → Bacteria8128Open in IMG/M
3300000101|DelMOSum2010_c10016428All Organisms → cellular organisms → Bacteria4480Open in IMG/M
3300000101|DelMOSum2010_c10034735All Organisms → Viruses → Predicted Viral2719Open in IMG/M
3300000115|DelMOSum2011_c10007836All Organisms → cellular organisms → Bacteria5930Open in IMG/M
3300000115|DelMOSum2011_c10060221All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300000115|DelMOSum2011_c10077114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1173Open in IMG/M
3300000115|DelMOSum2011_c10198275All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300000117|DelMOWin2010_c10015118All Organisms → cellular organisms → Bacteria4206Open in IMG/M
3300001450|JGI24006J15134_10035735All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300001450|JGI24006J15134_10111614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium962Open in IMG/M
3300001460|JGI24003J15210_10018009All Organisms → Viruses → Predicted Viral2729Open in IMG/M
3300001460|JGI24003J15210_10049840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1402Open in IMG/M
3300001460|JGI24003J15210_10058038All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300001472|JGI24004J15324_10129208All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300001589|JGI24005J15628_10027737All Organisms → Viruses → Predicted Viral2381Open in IMG/M
3300003588|JGI26247J51722_1003541All Organisms → cellular organisms → Bacteria5479Open in IMG/M
3300004457|Ga0066224_1070231All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300006027|Ga0075462_10049995All Organisms → Viruses → Predicted Viral1329Open in IMG/M
3300006029|Ga0075466_1002690All Organisms → cellular organisms → Bacteria → Proteobacteria6546Open in IMG/M
3300006029|Ga0075466_1096640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium805Open in IMG/M
3300006029|Ga0075466_1177122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium537Open in IMG/M
3300006735|Ga0098038_1065940All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300006737|Ga0098037_1242319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium580Open in IMG/M
3300006752|Ga0098048_1002488All Organisms → cellular organisms → Bacteria7747Open in IMG/M
3300006789|Ga0098054_1334210All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006802|Ga0070749_10151419All Organisms → Viruses → Predicted Viral1348Open in IMG/M
3300006802|Ga0070749_10429870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium725Open in IMG/M
3300006803|Ga0075467_10061153All Organisms → cellular organisms → Bacteria2319Open in IMG/M
3300006803|Ga0075467_10080428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1971Open in IMG/M
3300006810|Ga0070754_10214332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium892Open in IMG/M
3300006810|Ga0070754_10429781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium575Open in IMG/M
3300006919|Ga0070746_10344678All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006924|Ga0098051_1005310All Organisms → Viruses → Predicted Viral4184Open in IMG/M
3300006925|Ga0098050_1010396All Organisms → Viruses → Predicted Viral2736Open in IMG/M
3300006929|Ga0098036_1132583All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300007229|Ga0075468_10219374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium548Open in IMG/M
3300007344|Ga0070745_1037572All Organisms → Viruses → Predicted Viral2044Open in IMG/M
3300007346|Ga0070753_1185918All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300007539|Ga0099849_1025710All Organisms → Viruses → Predicted Viral2541Open in IMG/M
3300007960|Ga0099850_1267241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium656Open in IMG/M
3300007963|Ga0110931_1004318All Organisms → Viruses → Predicted Viral4554Open in IMG/M
3300008012|Ga0075480_10103435All Organisms → Viruses → Predicted Viral1593Open in IMG/M
3300009001|Ga0102963_1252607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium697Open in IMG/M
3300009058|Ga0102854_1257977All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009074|Ga0115549_1173691All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300009433|Ga0115545_1070912All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300009495|Ga0115571_1135023All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300009507|Ga0115572_10115846All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300009507|Ga0115572_10671174All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010149|Ga0098049_1159916All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300011129|Ga0151672_103825All Organisms → Viruses → Predicted Viral3197Open in IMG/M
3300017706|Ga0181377_1040047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium931Open in IMG/M
3300017708|Ga0181369_1001592All Organisms → cellular organisms → Bacteria6400Open in IMG/M
3300017724|Ga0181388_1013571All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300017725|Ga0181398_1020649All Organisms → Viruses → Predicted Viral1641Open in IMG/M
3300017730|Ga0181417_1170331All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300017730|Ga0181417_1182724Not Available505Open in IMG/M
3300017732|Ga0181415_1017036All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300017733|Ga0181426_1133163All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300017734|Ga0187222_1053569All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300017741|Ga0181421_1036741All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300017746|Ga0181389_1084127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium890Open in IMG/M
3300017752|Ga0181400_1061313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1147Open in IMG/M
3300017753|Ga0181407_1028187All Organisms → Viruses → Predicted Viral1522Open in IMG/M
3300017756|Ga0181382_1044632Not Available1295Open in IMG/M
3300017756|Ga0181382_1093596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium819Open in IMG/M
3300017764|Ga0181385_1112114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium834Open in IMG/M
3300020347|Ga0211504_1030145All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300020438|Ga0211576_10043636All Organisms → cellular organisms → Bacteria2590Open in IMG/M
3300021375|Ga0213869_10075989All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300021378|Ga0213861_10212240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1047Open in IMG/M
3300021389|Ga0213868_10111490All Organisms → Viruses → Predicted Viral1747Open in IMG/M
3300021957|Ga0222717_10012685All Organisms → cellular organisms → Bacteria5807Open in IMG/M
3300021961|Ga0222714_10243469All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300022072|Ga0196889_1062251All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300022072|Ga0196889_1070264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium660Open in IMG/M
3300022074|Ga0224906_1003712All Organisms → cellular organisms → Bacteria6672Open in IMG/M
3300022164|Ga0212022_1027197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium871Open in IMG/M
3300022178|Ga0196887_1095812All Organisms → cellular organisms → Bacteria670Open in IMG/M
(restricted) 3300023210|Ga0233412_10007617All Organisms → cellular organisms → Bacteria4504Open in IMG/M
(restricted) 3300024520|Ga0255047_10111653All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300025026|Ga0207879_105738All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025048|Ga0207905_1045450All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025071|Ga0207896_1009274All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300025079|Ga0207890_1008319All Organisms → Viruses2259Open in IMG/M
3300025120|Ga0209535_1141687All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300025120|Ga0209535_1158239All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300025127|Ga0209348_1025569All Organisms → Viruses → Predicted Viral2161Open in IMG/M
3300025128|Ga0208919_1006431All Organisms → cellular organisms → Bacteria5167Open in IMG/M
3300025137|Ga0209336_10100354All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300025137|Ga0209336_10101139All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300025138|Ga0209634_1029327All Organisms → Viruses2937Open in IMG/M
3300025543|Ga0208303_1002957All Organisms → cellular organisms → Bacteria → Proteobacteria6284Open in IMG/M
3300025652|Ga0208134_1024175All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300025652|Ga0208134_1068699All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300025759|Ga0208899_1000134All Organisms → cellular organisms → Bacteria45178Open in IMG/M
3300025806|Ga0208545_1169524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium507Open in IMG/M
3300025853|Ga0208645_1248316All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300025887|Ga0208544_10285983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium647Open in IMG/M
3300028125|Ga0256368_1012379All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300031766|Ga0315322_10301410All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300032277|Ga0316202_10099217All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300032373|Ga0316204_10565678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium839Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.16%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous27.18%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater14.56%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine7.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.85%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.91%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.94%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.94%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.94%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.97%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.97%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.97%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300003588Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNAEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300011129Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025026Marine viral communities from the Pacific Ocean - LP-24 (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1000645473300000101MarineMNEAWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
DelMOSum2010_1001642873300000101MarineMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPAS
DelMOSum2010_1003473573300000101MarineMDGWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIVMSGIPASGQFTCRKVGVDT*
DelMOSum2011_1000783673300000115MarineMNEAWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPAS
DelMOSum2011_1006022153300000115MarineINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGQFTCRNVGVNT*
DelMOSum2011_1007711423300000115MarineMDSWVLYFLIVFINGDSFVXENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
DelMOSum2011_1019827523300000115MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVG
DelMOWin2010_1001511813300000117MarineMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRV
JGI24006J15134_1003573553300001450MarineMMDSWVLYFLISFINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGQFTCRNVGVNT*
JGI24006J15134_1011161423300001450MarineMNEAWILYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
JGI24003J15210_1001800933300001460MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
JGI24003J15210_1004984033300001460MarineMDGWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIVMSGITASGQFTCRKVGVDT*
JGI24003J15210_1005803843300001460MarineMNETWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
JGI24004J15324_1012920823300001472MarineMNETWILYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCS
JGI24005J15628_1002773733300001589MarineMDGWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIVMSGIXASGQFTCRKVGVDT*
JGI26247J51722_100354163300003588MarineMDSWVLYFLIVFISGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT*
Ga0066224_107023153300004457MarineMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
Ga0075462_1004999553300006027AqueousWCIGWWYLLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0075466_100269083300006029AqueousMNEAWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVG
Ga0075466_109664023300006029AqueousMDSWVLYFLIVFINGDSFVLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
Ga0075466_117712213300006029AqueousYLLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0098038_106594023300006735MarineMNEAWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIILMSGIPASGQFTCSRVGVDT*
Ga0098037_124231913300006737MarineDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0098048_100248893300006752MarineMDSWVLYFLIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0098054_133421023300006789MarineMDSWVLYFFIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0070749_1015141923300006802AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0070749_1042987023300006802AqueousMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0075467_1006115343300006803AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0075467_1008042853300006803AqueousMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
Ga0070754_1021433243300006810AqueousVMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVNT*
Ga0070754_1042978123300006810AqueousMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0070746_1034467823300006919AqueousMDSWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGNSIVENIIIMSGIPASGQFTCSRVGVD
Ga0098051_100531083300006924MarineIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0098050_101039613300006925MarineSDPIMDSWVLYFLIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT*
Ga0098036_113258323300006929MarineMNEAWVLYFLIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIILMSGIPASGQFTCSRVGVDT*
Ga0075468_1021937423300007229AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0070745_103757263300007344AqueousLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVNT*
Ga0070753_118591823300007346AqueousMDSWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0099849_102571023300007539AqueousMDSWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
Ga0099850_126724123300007960AqueousYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT*
Ga0110931_100431813300007963MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIILMSGIPASGQFTCSRVGVDT*
Ga0075480_1010343523300008012AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGKFTCRNVGVDT*
Ga0102963_125260733300009001Pond WaterYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT*
Ga0102854_125797723300009058EstuarineMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT*
Ga0115549_117369113300009074Pelagic MarineMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIVMSGIPALGQFTCRKVGVDI*
Ga0115545_107091223300009433Pelagic MarineMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVNT*
Ga0115571_113502313300009495Pelagic MarineMDSWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIILMSGVPASGQFTCRKVGVDT*
Ga0115572_1011584643300009507Pelagic MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT*
Ga0115572_1067117423300009507Pelagic MarineMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVNT*
Ga0098049_115991623300010149MarineMNSWVLYFLIVFINGDSFILENNERFETKGECLIEGMKKGSSIVENIIVTSGIPATGQFTCRRIGVDI*
Ga0151672_10382583300011129MarineMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT*
Ga0181377_104004723300017706MarineMDSWVLYFFIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVGNIIIMSGIPASGQFTCRKVGVDT
Ga0181369_100159243300017708MarineMDSWVLYFFIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0181388_101357153300017724SeawaterMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSMVEKIILMSGIPASGQFTCRKVGVDT
Ga0181398_102064943300017725SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0181417_117033113300017730SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIILMSGIPASGQFTCSRVGVDT
Ga0181417_118272423300017730SeawaterLLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0181415_101703633300017732SeawaterMDSWVLYFLIVFINGDSFMLENNQRFEPKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0181426_113316323300017733SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPAS
Ga0187222_105356913300017734SeawaterFLIVFINGDSFMLENNQRFETKGECLIEGMQKGHSVVENIMIMSGIPASGQFTCRKVGVD
Ga0181421_103674153300017741SeawaterSHPVMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0181389_108412733300017746SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCSRVGVDT
Ga0181400_106131343300017752SeawaterINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIMMSGIPASGQFTCRKVGVDT
Ga0181407_102818753300017753SeawaterSHPVMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT
Ga0181382_104463253300017756SeawaterTSHPVMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0181382_109359643300017756SeawaterWCIEWWYLLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0181385_111211433300017764SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0211504_103014543300020347MarineMDSWVLYFLIVFINGDSFVLENNQRFETKRECLIEGMQKGSSIVENIILMSGIPASGQFTCRKVGVDT
Ga0211576_1004363653300020438MarineMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0213869_1007598933300021375SeawaterMNEAWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0213861_1021224023300021378SeawaterMDSWVLYFLIVFINGDSFVLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0213868_1011149023300021389SeawaterMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0222717_1001268593300021957Estuarine WaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT
Ga0222714_1024346913300021961Estuarine WaterYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVVENIIIMSGIPASGQFTCRKVGVDT
Ga0196889_106225123300022072AqueousMDSWVLYFLIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0196889_107026423300022072AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0224906_100371263300022074SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKSECLIEGMQKGSSVVENIIMMSGIPASGQFTCRKVGVDT
Ga0212022_102719743300022164AqueousMDSWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT
Ga0196887_109581223300022178AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCSRVGVDT
(restricted) Ga0233412_1000761763300023210SeawaterMDSWVLYFLIVFISGDSFMLENNQRFETKGECLIEGMQKGSSVVENIMIMSGIPASGQFTCRKVGVDT
(restricted) Ga0255047_1011165323300024520SeawaterMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0207879_10573813300025026MarineMDGWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIVMSGITASGQFTCRKVGVDT
Ga0207905_104545013300025048MarineMDSWVLYFLISFINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGQFTCRNVGVNT
Ga0207896_100927433300025071MarineMMDSWVLYFLISFINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGQFTCRNVGVNT
Ga0207890_100831963300025079MarineMMDSWVLYFLISFINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGKFTCRNVGVDT
Ga0209535_114168713300025120MarineMNEAWALYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGHSVVENIMIMSGIPASGQFTCRKVGVDT
Ga0209535_115823923300025120MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0209348_102556933300025127MarineMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0208919_100643183300025128MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIILMSGIPASGQFTCSRVGVDT
Ga0209336_1010035423300025137MarineMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSIVENIILMSGIPASGQFTCNRVGVDT
Ga0209336_1010113923300025137MarineMNEAWILYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSRVGVDT
Ga0209634_102932773300025138MarineMMDSWVLYFLISFINGDSFVLENDQRFETKKECLAEGMQKGHTIVENVIIMSGMPVSGQFTCRNVGVDT
Ga0208303_100295793300025543AqueousMDSWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT
Ga0208134_102417553300025652AqueousMDSWVLYFLIVFINGDSFVLENNQRFETKGECLIEGMQKGSSIVENIIIMSGIPASGQFTCSR
Ga0208134_106869913300025652AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCS
Ga0208899_1000134293300025759AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0208545_116952423300025806AqueousWWYLLDYFGYSMNEAWVLYFLIVFINGDSFMLENNQRFETKGECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT
Ga0208645_124831613300025853AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQF
Ga0208544_1028598323300025887AqueousMNEAWVLYFLIVFINGDSFMLENNQRFETKDECLIEGMQKGSSVIENIMIMSGIPASGQFTCRKVGVDT
Ga0256368_101237933300028125Sea-Ice BrineMDGWVLYFLIVFINGDSFMLENNQRFETKRECLIEGMQKGSSIVENIIVMSGIPASGQFTCRKVGVDT
Ga0315322_1030141043300031766SeawaterMDSWVLYFFIVFINGDSFVLENNQRFETKDECLIEGMQKGSSIIENIIIMSGIPASGQFTCRKVGVDT
Ga0316202_1009921743300032277Microbial MatMDSWVLYFLIVFINGDSFVLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT
Ga0316204_1056567833300032373Microbial MatMDSWVLYFLIVFINGDSFMLENNQRFETRGECLIEGMQKGSSIVENIIIMSGIPASGQFTCRKVGVDT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.