Metagenome / Metatranscriptome Family F100195

Basic Information
Family ID	F100195
Family Type	Metagenome / Metatranscriptome
Number of Sequences	102
Average Sequence Length	39 residues
Representative Sequence	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS
Number of Associated Samples	63
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.02 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Most Common Taxonomy
Group	Unclassified (99.020 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (44.118 % of family members)
Environment Ontology (ENVO)	Unclassified (71.569 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (69.608 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78%
Feature Viewer

Powered by Feature Viewer

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
All Organisms	root	All Organisms	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
cellular organisms	root	All Organisms → cellular organisms	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Salmonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
unclassified Salmonella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Salmonella sp. zj-f54	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. zj-f54	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005335\|Ga0070666_10471094	Not Available	909	Open in IMG/M
3300005335\|Ga0070666_10869950	Not Available	665	Open in IMG/M
3300005335\|Ga0070666_11090122	Not Available	593	Open in IMG/M
3300005347\|Ga0070668_100395153	Not Available	1179	Open in IMG/M
3300005355\|Ga0070671_101123415	Not Available	691	Open in IMG/M
3300005355\|Ga0070671_101715255	Not Available	557	Open in IMG/M
3300005365\|Ga0070688_101615102	Not Available	529	Open in IMG/M
3300005367\|Ga0070667_102248779	Not Available	514	Open in IMG/M
3300005618\|Ga0068864_100700390	Not Available	989	Open in IMG/M
3300005618\|Ga0068864_100826949	Not Available	911	Open in IMG/M
3300005618\|Ga0068864_101300289	Not Available	727	Open in IMG/M
3300005618\|Ga0068864_102149948	Not Available	564	Open in IMG/M
3300005618\|Ga0068864_102383667	Not Available	535	Open in IMG/M
3300005719\|Ga0068861_100991045	Not Available	801	Open in IMG/M
3300005719\|Ga0068861_102705249	Not Available	500	Open in IMG/M
3300005841\|Ga0068863_101610358	Not Available	658	Open in IMG/M
3300005842\|Ga0068858_100603732	Not Available	1064	Open in IMG/M
3300005842\|Ga0068858_101936730	Not Available	582	Open in IMG/M
3300005842\|Ga0068858_102160013	Not Available	550	Open in IMG/M
3300005842\|Ga0068858_102174694	Not Available	548	Open in IMG/M
3300005843\|Ga0068860_102532645	Not Available	532	Open in IMG/M
3300005844\|Ga0068862_101560734	Not Available	666	Open in IMG/M
3300009553\|Ga0105249_11982331	Not Available	655	Open in IMG/M
3300009553\|Ga0105249_12355578	Not Available	605	Open in IMG/M
3300010268\|Ga0134097_1076249	Not Available	553	Open in IMG/M
3300010371\|Ga0134125_11626287	Not Available	703	Open in IMG/M
3300010371\|Ga0134125_12316242	Not Available	584	Open in IMG/M
3300014325\|Ga0163163_10764551	Not Available	1029	Open in IMG/M
3300015280\|Ga0182100_1092184	Not Available	517	Open in IMG/M
3300015290\|Ga0182105_1104646	Not Available	508	Open in IMG/M
3300015293\|Ga0182103_1019164	Not Available	844	Open in IMG/M
3300015297\|Ga0182104_1098350	Not Available	542	Open in IMG/M
3300015311\|Ga0182182_1037903	Not Available	755	Open in IMG/M
3300015311\|Ga0182182_1039535	Not Available	745	Open in IMG/M
3300015311\|Ga0182182_1077079	Not Available	595	Open in IMG/M
3300015311\|Ga0182182_1085891	Not Available	573	Open in IMG/M
3300015312\|Ga0182168_1120592	Not Available	529	Open in IMG/M
3300015315\|Ga0182120_1110466	Not Available	552	Open in IMG/M
3300015315\|Ga0182120_1138201	Not Available	504	Open in IMG/M
3300015316\|Ga0182121_1140003	Not Available	511	Open in IMG/M
3300015319\|Ga0182130_1040459	Not Available	774	Open in IMG/M
3300015324\|Ga0182134_1031099	Not Available	884	Open in IMG/M
3300015325\|Ga0182148_1016395	Not Available	1050	Open in IMG/M
3300015326\|Ga0182166_1130798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. zj-f54	524	Open in IMG/M
3300015330\|Ga0182152_1045769	Not Available	797	Open in IMG/M
3300015330\|Ga0182152_1064031	Not Available	708	Open in IMG/M
3300015331\|Ga0182131_1017365	Not Available	1086	Open in IMG/M
3300015335\|Ga0182116_1066128	Not Available	762	Open in IMG/M
3300015337\|Ga0182151_1011492	Not Available	1252	Open in IMG/M
3300015337\|Ga0182151_1158185	Not Available	513	Open in IMG/M
3300015348\|Ga0182115_1288354	Not Available	519	Open in IMG/M
3300015349\|Ga0182185_1109151	Not Available	801	Open in IMG/M
3300015349\|Ga0182185_1133861	Not Available	731	Open in IMG/M
3300015349\|Ga0182185_1280969	Not Available	508	Open in IMG/M
3300015350\|Ga0182163_1266276	Not Available	537	Open in IMG/M
3300015350\|Ga0182163_1295972	Not Available	506	Open in IMG/M
3300015350\|Ga0182163_1301475	Not Available	500	Open in IMG/M
3300015352\|Ga0182169_1080349	Not Available	1025	Open in IMG/M
3300015352\|Ga0182169_1141993	Not Available	781	Open in IMG/M
3300015352\|Ga0182169_1245021	Not Available	583	Open in IMG/M
3300015352\|Ga0182169_1308284	Not Available	509	Open in IMG/M
3300015353\|Ga0182179_1188676	Not Available	653	Open in IMG/M
3300015353\|Ga0182179_1240296	Not Available	583	Open in IMG/M
3300015353\|Ga0182179_1269911	Not Available	550	Open in IMG/M
3300015354\|Ga0182167_1177308	Not Available	784	Open in IMG/M
3300017412\|Ga0182199_1045131	Not Available	884	Open in IMG/M
3300017435\|Ga0182194_1017425	Not Available	1116	Open in IMG/M
3300017435\|Ga0182194_1123917	Not Available	547	Open in IMG/M
3300017439\|Ga0182200_1166041	Not Available	500	Open in IMG/M
3300017692\|Ga0182210_1112687	Not Available	591	Open in IMG/M
3300017693\|Ga0182216_1063733	Not Available	821	Open in IMG/M
3300017693\|Ga0182216_1180368	Not Available	549	Open in IMG/M
3300025903\|Ga0207680_11286891	Not Available	520	Open in IMG/M
3300026035\|Ga0207703_12058250	Not Available	547	Open in IMG/M
3300028049\|Ga0268322_1020700	Not Available	702	Open in IMG/M
3300028049\|Ga0268322_1025770	Not Available	656	Open in IMG/M
3300028049\|Ga0268322_1049323	Not Available	528	Open in IMG/M
3300028050\|Ga0268328_1053801	Not Available	560	Open in IMG/M
3300028050\|Ga0268328_1063775	Not Available	525	Open in IMG/M
3300028052\|Ga0268300_1012181	Not Available	501	Open in IMG/M
3300028053\|Ga0268346_1007027	Not Available	878	Open in IMG/M
3300028056\|Ga0268330_1004764	Not Available	1157	Open in IMG/M
3300028056\|Ga0268330_1013954	Not Available	837	Open in IMG/M
3300028056\|Ga0268330_1036501	Not Available	612	Open in IMG/M
3300028056\|Ga0268330_1059171	Not Available	513	Open in IMG/M
3300028056\|Ga0268330_1059493	Not Available	512	Open in IMG/M
3300028058\|Ga0268332_1002230	Not Available	1482	Open in IMG/M
3300028063\|Ga0268350_1046658	Not Available	629	Open in IMG/M
3300028064\|Ga0268340_1017789	Not Available	862	Open in IMG/M
3300028139\|Ga0268355_1006750	Not Available	690	Open in IMG/M
3300028142\|Ga0268347_1007748	Not Available	790	Open in IMG/M
3300028143\|Ga0268348_1023244	Not Available	522	Open in IMG/M
3300028151\|Ga0268308_1004378	Not Available	961	Open in IMG/M
3300028151\|Ga0268308_1005610	Not Available	888	Open in IMG/M
3300028151\|Ga0268308_1007726	Not Available	805	Open in IMG/M
3300028152\|Ga0268336_1015336	Not Available	625	Open in IMG/M
3300028154\|Ga0268341_1004772	Not Available	887	Open in IMG/M
3300028256\|Ga0268304_1015625	Not Available	505	Open in IMG/M
3300028464\|Ga0268302_106395	Not Available	562	Open in IMG/M
3300028472\|Ga0268315_1001889	Not Available	1090	Open in IMG/M
3300028473\|Ga0268319_1011698	Not Available	630	Open in IMG/M
3300032467\|Ga0214488_1106884	Not Available	603	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.08%
Environmental	Environmental	2.94%
Engineered	Engineered	0.98%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.08%
Terrestrial	Environmental → Terrestrial	2.94%
Bioreactor	Engineered → Bioreactor	0.98%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	70.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.80%
Soil	Environmental → Terrestrial → Soil	2.94%
Roots	Host-Associated → Plants → Roots	0.98%
Unclassified	Engineered → Bioreactor → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	70.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.96%
Loam	Environmental → Terrestrial → Soil → Loam	0.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	70.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	44.12%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	26.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	14.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.84%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010268	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 8_30_10_142_A2 metaG	Engineered	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_104710941	3300005335	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLTFTILLDTSMHFYIGFDDS*
Ga0070666_108699501	3300005335	Switchgrass Rhizosphere	FLFGHNEHAQSTTLGLKLMSTILLDTSMHFYIAFDDSYCR*
Ga0070666_110901221	3300005335	Switchgrass Rhizosphere	LGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0070668_1003951533	3300005347	Switchgrass Rhizosphere	LCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0070671_1011234152	3300005355	Switchgrass Rhizosphere	TSLCLGNHFLFGRNEHAQSTTLGLKLMFAILLDTSMHFYVAFDDS*
Ga0070671_1017152552	3300005355	Switchgrass Rhizosphere	SSLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0070688_1016151021	3300005365	Switchgrass Rhizosphere	SLCLGNHFLFGRDEHAQSTTLGLILMFTILLDTSMHFYIAFDDS*
Ga0070667_1022487791	3300005367	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0068864_1007003901	3300005618	Switchgrass Rhizosphere	LLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0068864_1008269494	3300005618	Switchgrass Rhizosphere	SLCLGNYFLFGHNEHSQSTTLGLKLMFTILHYTSMHFYVASDDS*
Ga0068864_1013002893	3300005618	Switchgrass Rhizosphere	GRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0068864_1021499482	3300005618	Switchgrass Rhizosphere	TSLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0068864_1023836671	3300005618	Switchgrass Rhizosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDN*
Ga0068861_1009910454	3300005719	Switchgrass Rhizosphere	SLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0068861_1027052492	3300005719	Switchgrass Rhizosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0068863_1016103581	3300005841	Switchgrass Rhizosphere	LGNHFWFGRNEHAQSTTLGLKLMLTILLETSMHFYIAFDDS*
Ga0068858_1006037321	3300005842	Switchgrass Rhizosphere	FLLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0068858_1019367302	3300005842	Switchgrass Rhizosphere	MFGRSEHAQSTALGLKIMFTILLDTSMHFYIAFDDS*
Ga0068858_1021600133	3300005842	Switchgrass Rhizosphere	STSLCLGNHFLFGHNEHSQSTTLGLKLRFIILLDTSMHFYIAFVDS*
Ga0068858_1021746941	3300005842	Switchgrass Rhizosphere	IFLLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFGDT*
Ga0068860_1025326451	3300005843	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDNS*
Ga0068862_1015607342	3300005844	Switchgrass Rhizosphere	LGNYFLFGHNEHSQSTTLGLKLMFTILHYTSMHF*
Ga0105249_119823311	3300009553	Switchgrass Rhizosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0105249_123555782	3300009553	Switchgrass Rhizosphere	GRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS*
Ga0134097_10762491	3300010268	Switchgrass Degrading	NHFLFGRNEHAQSTTLGLKLMFTIPLDTSMHFYKAFDDT*
Ga0134125_116262871	3300010371	Terrestrial Soil	GRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0134125_123162421	3300010371	Terrestrial Soil	NHFLFGRNEYSQSTSLGLKLMFTILLDTSMQFYIAFDDS*
Ga0163163_107645512	3300014325	Switchgrass Rhizosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS*
Ga0182100_10921841	3300015280	Switchgrass Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182105_11046462	3300015290	Switchgrass Phyllosphere	LGRNEHAQSTTLGQKLIFTIFLDTSMHIYKDFDDT*
Ga0182103_10191641	3300015293	Switchgrass Phyllosphere	STLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDR*
Ga0182104_10983501	3300015297	Switchgrass Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILHDTSMHFYIVFDDC*
Ga0182182_10379031	3300015311	Switchgrass Phyllosphere	NHFLFGHNEHSQSTTLGLKLRFTILLDTSMHFYVAFVDS*
Ga0182182_10395351	3300015311	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIGFDDN*
Ga0182182_10770792	3300015311	Switchgrass Phyllosphere	LFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0182182_10858911	3300015311	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDRSMHFYKAFDNS*
Ga0182168_11205921	3300015312	Switchgrass Phyllosphere	FGRNEHAQSTTLGLKLIFSILLDTSIHFYIAFDNS*
Ga0182120_11104661	3300015315	Switchgrass Phyllosphere	GRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0182120_11382012	3300015315	Switchgrass Phyllosphere	GNHFLFGRNEHDQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182121_11400031	3300015316	Switchgrass Phyllosphere	FGRNEHAQSTSLGLKLMFTILLDTSMHFYIAFDDI*
Ga0182130_10404591	3300015319	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182134_10310991	3300015324	Switchgrass Phyllosphere	GRNEHAQSITLGLKLMFTILLDTSMHFYIAFDNS*
Ga0182148_10163952	3300015325	Switchgrass Phyllosphere	FFFDRYKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182166_11307981	3300015326	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYKAFDDS*
Ga0182152_10457691	3300015330	Switchgrass Phyllosphere	TSLCLENHFLFGHNEHAQSTTLGLKLMFTILFDTSMHFYIASDDS*
Ga0182152_10640311	3300015330	Switchgrass Phyllosphere	HFLFGHNEHAQSTTLGLKLMFTILLDTSMQFYIAFDDS*
Ga0182131_10173652	3300015331	Switchgrass Phyllosphere	FDRNKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182116_10661281	3300015335	Switchgrass Phyllosphere	LFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFEDS*
Ga0182151_10114921	3300015337	Switchgrass Phyllosphere	GNHFLFGHNEHAQSTTLGLKLMFTIMLDTSLHFYIAFDDN*
Ga0182151_11581851	3300015337	Switchgrass Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0182115_12883542	3300015348	Switchgrass Phyllosphere	GHNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0182185_11091511	3300015349	Switchgrass Phyllosphere	LFGRNEHVQSTALGLKLMFTIMLYTSMHFYRAFEYS*
Ga0182185_11338611	3300015349	Switchgrass Phyllosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIVFDDS*
Ga0182185_12809691	3300015349	Switchgrass Phyllosphere	FGCNEHAQSTTLGLKLMFTILIDTLMHLYIAFDDS*
Ga0182163_12662761	3300015350	Switchgrass Phyllosphere	GRNKRAQSTTIGLKLMFTILLEASMHFYITCDDN*
Ga0182163_12959721	3300015350	Switchgrass Phyllosphere	LFGRSEHAQSTTLGLKIMFTILPDTSMHFCIAFDES*
Ga0182163_13014751	3300015350	Switchgrass Phyllosphere	FLFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182169_10803492	3300015352	Switchgrass Phyllosphere	FLFGRNKHAQSTTLDLKLMFSILLDTPMHFYIAFDDS*
Ga0182169_11419931	3300015352	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYEAFDDS*
Ga0182169_12450211	3300015352	Switchgrass Phyllosphere	HFFFGRNEPAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182169_13082841	3300015352	Switchgrass Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0182179_11886761	3300015353	Switchgrass Phyllosphere	MSLCLQNHFLFGRNEHAQSTTLGLKLMFTIMLDTSMHF
Ga0182179_12402962	3300015353	Switchgrass Phyllosphere	GNHFLFVRNEHAQSTTLGLKLMFTILLDTLMHFYIAFDNS*
Ga0182179_12699111	3300015353	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYVAFDDS*
Ga0182167_11773081	3300015354	Switchgrass Phyllosphere	GRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182199_10451312	3300017412	Switchgrass Phyllosphere	LFGHNEHYQSTTLGLKLMSTILLDTSMHFYIAFDDS
Ga0182194_10174252	3300017435	Switchgrass Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDNSMHFYIAFDNS
Ga0182194_11239172	3300017435	Switchgrass Phyllosphere	FSRNEHAQSTTLGLKFMFTILLDTSMHFYIAFDDS
Ga0182200_11660411	3300017439	Switchgrass Phyllosphere	FGRNEHAQSTTLGLKLMFTILLDRSMHFYKAFDNS
Ga0182210_11126872	3300017692	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLTFTILLDTSMHFYIGFDDS
Ga0182216_10637332	3300017693	Switchgrass Phyllosphere	LENHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0182216_11803682	3300017693	Switchgrass Phyllosphere	LFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS
Ga0207680_112868911	3300025903	Switchgrass Rhizosphere	MSLCLRNYFLFGRNEQAQSMTLGLKLMFTILLDTSMHFSIAFDD
Ga0207703_120582502	3300026035	Switchgrass Rhizosphere	LFGRNEHAQSTTLGLKLMFTILLDTSMHFYEAFDDS
Ga0268322_10207001	3300028049	Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYVDFDDS
Ga0268322_10257701	3300028049	Phyllosphere	FLFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS
Ga0268322_10493231	3300028049	Phyllosphere	HFLFGRDEHAQSTTLGLILMFTILLDTSMHFYIAFDDS
Ga0268328_10538011	3300028050	Phyllosphere	FLFGRNEHAQSTTLGLQLMFTILLDTSMHFYIAFDDS
Ga0268328_10637751	3300028050	Phyllosphere	FLFGHNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDN
Ga0268300_10121811	3300028052	Phyllosphere	GNHSLFARNEHAQSTTLGLKLMFTILLDTSMHFYVAFDDS
Ga0268346_10070271	3300028053	Phyllosphere	SLCLRNHFLFGRNERAQSTTIGLELMFTILLEASMHFYITCDDS
Ga0268330_10047642	3300028056	Phyllosphere	LCLGKHFLFGRNEHAQSITLGLKLLLDTSMHFYIAFDDN
Ga0268330_10139541	3300028056	Phyllosphere	FLFYRNEHAQSITLGLKLMFTILLDTSMHFYIAFDNS
Ga0268330_10365011	3300028056	Phyllosphere	RNHFLFGRNKHAQSTTLGLKLMFIILLDTSMHFYIAFDDS
Ga0268330_10591711	3300028056	Phyllosphere	SLFGRNEHAQSTSLGLKLMFTILLDTSMHFYIAFDDI
Ga0268330_10594931	3300028056	Phyllosphere	FLFGRNEHAQSTTLGQNLMFTILLDTSMHFYIDFDDS
Ga0268332_10022303	3300028058	Phyllosphere	IFDRNKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS
Ga0268350_10466581	3300028063	Phyllosphere	FGRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS
Ga0268340_10177892	3300028064	Phyllosphere	LFGRNEHAQSTALGLKLMFTILLNNSMHFYVDFDDS
Ga0268355_10067501	3300028139	Phyllosphere	RNHFLFGHNEHAQSTSLGLKLMFTILLDTSMHFYIAFADS
Ga0268347_10077481	3300028142	Phyllosphere	ENQFLFGRNEHAQSTTLGLKLMFTILLDNSIHFYKAFYDS
Ga0268348_10232441	3300028143	Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYVDFDDS
Ga0268308_10043781	3300028151	Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDEC
Ga0268308_10056102	3300028151	Phyllosphere	LGNHFLFGRNEHAQSTTLGLKLMFTILLDTSVHFYIAFEDR
Ga0268308_10077261	3300028151	Phyllosphere	LFGRNEHAQSTTLGLKLMFSILLNTSMHFYIAFDDS
Ga0268336_10153361	3300028152	Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS
Ga0268341_10047721	3300028154	Phyllosphere	LCLENHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDES
Ga0268304_10156251	3300028256	Phyllosphere	FGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS
Ga0268302_1063951	3300028464	Phyllosphere	ENHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0268315_10018893	3300028472	Phyllosphere	HEFVPRNHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0268319_10116981	3300028473	Phyllosphere	GNHFLFGRNEHAQSTTLGLKLMFTILFDTSMHFYIAFDDS
Ga0214488_11068841	3300032467	Switchgrass Phyllosphere	LFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F100195

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign