Basic Information | |
---|---|
Family ID | F100400 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 45 residues |
Representative Sequence | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFA |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 95.79 % |
% of genes near scaffold ends (potentially truncated) | 92.16 % |
% of genes from short scaffolds (< 2000 bps) | 84.31 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (71.569 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.255 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.078 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 88.89% β-sheet: 0.00% Coil/Unstructured: 11.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 6.86 |
PF13392 | HNH_3 | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.20 % |
Unclassified | root | N/A | 9.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003499|JGI25930J51415_1024817 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300005581|Ga0049081_10306962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300005662|Ga0078894_10071063 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3006 | Open in IMG/M |
3300005662|Ga0078894_10679406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
3300005662|Ga0078894_11419034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300007590|Ga0102917_1236046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300007597|Ga0102919_1029657 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
3300007600|Ga0102920_1202639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300007603|Ga0102921_1279571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300007620|Ga0102871_1224833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300007624|Ga0102878_1234966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300007716|Ga0102867_1111400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300007974|Ga0105747_1204086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300008107|Ga0114340_1132292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
3300008108|Ga0114341_10239332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300008108|Ga0114341_10532426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300008110|Ga0114343_1038927 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1918 | Open in IMG/M |
3300008110|Ga0114343_1173074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300008110|Ga0114343_1188214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300008111|Ga0114344_1054959 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300008111|Ga0114344_1250947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300008113|Ga0114346_1076430 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
3300008114|Ga0114347_1018239 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4908 | Open in IMG/M |
3300008120|Ga0114355_1252408 | Not Available | 518 | Open in IMG/M |
3300008120|Ga0114355_1256951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300008258|Ga0114840_1029119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300008262|Ga0114337_1156401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300008448|Ga0114876_1264060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300008450|Ga0114880_1186195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300008450|Ga0114880_1202100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300008961|Ga0102887_1068295 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
3300009180|Ga0114979_10538226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300010160|Ga0114967_10145654 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
3300010354|Ga0129333_10049590 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3935 | Open in IMG/M |
3300010354|Ga0129333_11494908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300010354|Ga0129333_11707586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300012764|Ga0157624_1081952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300013295|Ga0170791_10105727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300020141|Ga0211732_1310377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300020172|Ga0211729_10643671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300021962|Ga0222713_10560966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300021963|Ga0222712_10345296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300021963|Ga0222712_10760390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300023184|Ga0214919_10562646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300024346|Ga0244775_10488775 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
3300024346|Ga0244775_10604904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300027125|Ga0255106_1045853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300027147|Ga0255113_1082131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300027148|Ga0255115_1000599 | Not Available | 10433 | Open in IMG/M |
3300027151|Ga0255063_1000045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29096 | Open in IMG/M |
3300027186|Ga0208797_1024848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300027188|Ga0208921_1000589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6775 | Open in IMG/M |
3300027193|Ga0208800_1043900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300027232|Ga0208803_1064672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300027244|Ga0208173_1044018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300027281|Ga0208440_1032423 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
3300027281|Ga0208440_1066489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300027294|Ga0208441_1038527 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300027301|Ga0255127_1047348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300027320|Ga0208923_1079804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300027375|Ga0255137_1090419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300027529|Ga0255077_1114069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300027534|Ga0255125_1028127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300027571|Ga0208897_1010290 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2843 | Open in IMG/M |
3300027589|Ga0255123_1064326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300027593|Ga0255118_1028797 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
3300027595|Ga0255122_1021598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
3300027710|Ga0209599_10224703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300027732|Ga0209442_1315386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300027754|Ga0209596_1185262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300027793|Ga0209972_10200716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300027963|Ga0209400_1375925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300028025|Ga0247723_1056204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300028025|Ga0247723_1060231 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
3300028025|Ga0247723_1153206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300031758|Ga0315907_10592503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300031758|Ga0315907_10622699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300031758|Ga0315907_10951106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300031857|Ga0315909_10386414 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
3300031951|Ga0315904_10882643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300031951|Ga0315904_11393243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300031963|Ga0315901_10359317 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
3300031963|Ga0315901_10506508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300032093|Ga0315902_10459039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300032116|Ga0315903_10170273 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1973 | Open in IMG/M |
3300034018|Ga0334985_0362142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
3300034062|Ga0334995_0509788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300034082|Ga0335020_0009572 | Not Available | 5888 | Open in IMG/M |
3300034093|Ga0335012_0305555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300034102|Ga0335029_0019586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5161 | Open in IMG/M |
3300034108|Ga0335050_0324237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300034110|Ga0335055_0383623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300034272|Ga0335049_0605835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300034272|Ga0335049_0903422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300034284|Ga0335013_0416804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 16.67% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 14.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.73% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.78% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.92% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.94% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.94% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.98% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.98% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.98% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027232 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J13875_1026572 | 3300001267 | Freshwater | MDKGSFLENENQMVIDAEMQTIAEQLLDDWITTNLDEGTL |
JGI25930J51415_10248171 | 3300003499 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADK |
Ga0049081_103069621 | 3300005581 | Freshwater Lentic | MASFLEDVNQMVIDACYQDIAEQLLDDWINSNLDEGQYYADKQFAEMSGDKF |
Ga0078894_100710638 | 3300005662 | Freshwater Lake | MASFLEDVNQMVIDAVYQDISEQLLEQWINNNLDEG |
Ga0078894_106794062 | 3300005662 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQF |
Ga0078894_114190342 | 3300005662 | Freshwater Lake | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEG |
Ga0102917_12360462 | 3300007590 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFA |
Ga0102919_10296571 | 3300007597 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDE |
Ga0102920_12026392 | 3300007600 | Estuarine | MASFLEDVNQMVIDACYQDIAEQLLDDWINSNLDEGQYYADKQ |
Ga0102921_12795712 | 3300007603 | Estuarine | MASFLEDVNQMVIDACYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDK |
Ga0102871_12248331 | 3300007620 | Estuarine | MASFLEDVNQMVIDAVYQDISEQLLEQWINNNLDEGQYYADKQ |
Ga0102878_12349662 | 3300007624 | Estuarine | MASFLEDVNQMVIDSCYQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDSYI |
Ga0102867_11114002 | 3300007716 | Estuarine | MASFLEDVNQMVIDSCYQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDSY |
Ga0105747_12040862 | 3300007974 | Estuary Water | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQ |
Ga0114340_11322921 | 3300008107 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQ |
Ga0114341_102393321 | 3300008108 | Freshwater, Plankton | MPMSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGD |
Ga0114341_105324262 | 3300008108 | Freshwater, Plankton | MASFLEDVNQMVIDACYQDIAEQLLEGWINSNLDEGQYYADKQFAEMSGDE |
Ga0114343_10389271 | 3300008110 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDISEQLLEQWINNNLDEGQYYADKQFAEMSGDKFIYAE |
Ga0114343_11730741 | 3300008110 | Freshwater, Plankton | MSSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADK |
Ga0114343_11882141 | 3300008110 | Freshwater, Plankton | MSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADK |
Ga0114344_10549591 | 3300008111 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRF |
Ga0114344_12509472 | 3300008111 | Freshwater, Plankton | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFV |
Ga0114346_10764301 | 3300008113 | Freshwater, Plankton | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEM |
Ga0114347_101823910 | 3300008114 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDEDYL* |
Ga0114355_11725551 | 3300008120 | Freshwater, Plankton | MDKGSFIENENQMVIDAEMQTIAEQLLDDWITTNLDEGTLYSDW |
Ga0114355_12524081 | 3300008120 | Freshwater, Plankton | MPMSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDEFIY |
Ga0114355_12569512 | 3300008120 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDEFIY |
Ga0114840_10291192 | 3300008258 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFA |
Ga0114337_11564012 | 3300008262 | Freshwater, Plankton | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQD |
Ga0114876_12640602 | 3300008448 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEG |
Ga0114880_11861951 | 3300008450 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMS |
Ga0114880_12021001 | 3300008450 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDKF |
Ga0114880_12123121 | 3300008450 | Freshwater Lake | MSFLENENQMVIDAELQEIAEQLLEEWINSNLDEG |
Ga0102887_10682952 | 3300008961 | Estuarine | MASFLEDVNQMVIDSCYQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDSYIQSEFN |
Ga0114979_105382262 | 3300009180 | Freshwater Lake | MASFLEDVNQMVIDAVYQEIAEQLLEDWINNNLDEGQYYADKQFAEMS |
Ga0114967_101456541 | 3300010160 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFAEMS |
Ga0129333_100495901 | 3300010354 | Freshwater To Marine Saline Gradient | MASFLEDVNQMVIDACYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEF |
Ga0129333_104704601 | 3300010354 | Freshwater To Marine Saline Gradient | MDKGSFLENENQMVIDAEMQTIAEQLLDDWITTNLD |
Ga0129333_114949081 | 3300010354 | Freshwater To Marine Saline Gradient | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEF |
Ga0129333_117075861 | 3300010354 | Freshwater To Marine Saline Gradient | MASFLEDENQMVIDAELQAIADHLLTEWINSNLDEGQLYSDYQIASMCDSNYLK |
Ga0157624_10819522 | 3300012764 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSG |
Ga0170791_101057271 | 3300013295 | Freshwater | MASFLEDVNQMVIDSVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDK |
Ga0211732_13103771 | 3300020141 | Freshwater | MASFLEDVNQMVIDAVYQEIAEQLLEDWINNNLDEGQYYADKQFAEMSGD |
Ga0211729_106436712 | 3300020172 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDE |
Ga0222713_105609661 | 3300021962 | Estuarine Water | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYY |
Ga0222712_103452962 | 3300021963 | Estuarine Water | MASFLEDVNQMVIDACYQDIAEQLLEDWINNNLDEGQYYAD |
Ga0222712_107603902 | 3300021963 | Estuarine Water | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSG |
Ga0214919_105626461 | 3300023184 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFIQ |
Ga0244775_104887752 | 3300024346 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQY |
Ga0244775_106049041 | 3300024346 | Estuarine | MASFLEDVNQMVIDAVYQEIAEQLLEQWINNNLDEGQYY |
Ga0255106_10458532 | 3300027125 | Freshwater | MASFLEDVNQMVIDAVYQEIAEQLLENWINSNLDEGQYY |
Ga0255113_10821312 | 3300027147 | Freshwater | MASFLEDVNQMVIDAVYQEIAEQLLENWINSNLDEGQYYADKQF |
Ga0255115_10005991 | 3300027148 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFI |
Ga0255063_100004552 | 3300027151 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEM |
Ga0208797_10248482 | 3300027186 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYA |
Ga0208921_10005891 | 3300027188 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQ |
Ga0208800_10439001 | 3300027193 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEG |
Ga0208803_10646721 | 3300027232 | Estuarine | MASFLEDVNQMVIDSCYQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDS |
Ga0208173_10440182 | 3300027244 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYY |
Ga0208440_10324232 | 3300027281 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYY |
Ga0208440_10664892 | 3300027281 | Estuarine | MASFLEDVNQMVIDSCYQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDSYIQSE |
Ga0208441_10385271 | 3300027294 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQY |
Ga0255127_10473482 | 3300027301 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDNWINSNLEEGQYYADKQFAWMS |
Ga0208923_10798041 | 3300027320 | Estuarine | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDE |
Ga0255137_10904191 | 3300027375 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDNWINSNLEEGQYYADKQFAWMSDDKFIQSE |
Ga0255077_11140692 | 3300027529 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDR |
Ga0255125_10281272 | 3300027534 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDNWINSNLEEGQYYA |
Ga0208897_10102901 | 3300027571 | Estuarine | MASFLEDVNQMVIDACYQEIAEQLLEQWINNNLDEGQYYAD |
Ga0255123_10643261 | 3300027589 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDNWINSNLEEGQYYADKQFAWMSDDKFIQSEFN |
Ga0255118_10287971 | 3300027593 | Freshwater | MSSFLEDVNQMVIDACYQEIAEQLLENWINSNLDEGQYYADKQFAWMSDDKFIQSE |
Ga0255122_10215982 | 3300027595 | Freshwater | MASFLEDVNQMVIDAVYQEIAEQLLENWINSNLDEGQYYADKQFAWMS |
Ga0209599_102247032 | 3300027710 | Deep Subsurface | MASFLEDVNQMVIDAVYQEIAEQLLENWINSNLEEGQYYADKQFAWMSDDKFIQSEF |
Ga0209442_13153862 | 3300027732 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYAD |
Ga0209596_11852622 | 3300027754 | Freshwater Lake | MASFLEDVNQMVIDAVYQEIAEQLLEDWINNNLDEG |
Ga0209972_102007162 | 3300027793 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEG |
Ga0209400_13759252 | 3300027963 | Freshwater Lake | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFA |
Ga0247723_10562041 | 3300028025 | Deep Subsurface Sediment | MASFLEDVNQMVIDACYQDIAEQLLEDWINNNLDEGQYYA |
Ga0247723_10602312 | 3300028025 | Deep Subsurface Sediment | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADK |
Ga0247723_11532062 | 3300028025 | Deep Subsurface Sediment | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFIQ |
Ga0315907_105925032 | 3300031758 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDK |
Ga0315907_106226992 | 3300031758 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYA |
Ga0315907_109511061 | 3300031758 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYA |
Ga0315909_103864141 | 3300031857 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQ |
Ga0315904_107212572 | 3300031951 | Freshwater | MDKGSFLENENQMVIDAEMQTIAEQLLDDWITTNLDEGTLYS |
Ga0315904_108826431 | 3300031951 | Freshwater | MSSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQ |
Ga0315904_113932431 | 3300031951 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDE |
Ga0315901_103593172 | 3300031963 | Freshwater | MSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSGD |
Ga0315901_105065081 | 3300031963 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFI |
Ga0315902_104590392 | 3300032093 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAEMSG |
Ga0315903_101702731 | 3300032116 | Freshwater | MSSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQF |
Ga0334985_0362142_2_112 | 3300034018 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQ |
Ga0334995_0509788_3_140 | 3300034062 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAE |
Ga0335020_0009572_2_172 | 3300034082 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFVQSEF |
Ga0335012_0305555_668_805 | 3300034093 | Freshwater | MASFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEGQYYADKQFAE |
Ga0335029_0019586_3_119 | 3300034102 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYY |
Ga0335036_0017950_5602_5718 | 3300034106 | Freshwater | MDKGSFLENENQMVIDAEMQTIAEQLLDDWITTNLDEGT |
Ga0335050_0324237_3_158 | 3300034108 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKF |
Ga0335055_0383623_419_583 | 3300034110 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFVQS |
Ga0335049_0605835_571_678 | 3300034272 | Freshwater | MSSFLEDVNQMVIDAVYQDIAEQLLDDWINNNLDEG |
Ga0335049_0903422_1_117 | 3300034272 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDDWINSNLDEGQYY |
Ga0335007_0289672_968_1078 | 3300034283 | Freshwater | MDKGSFLENENQMVIDAEMQTIAEQLLDDWITTNLDE |
Ga0335013_0416804_672_821 | 3300034284 | Freshwater | MASFLEDVNQMVIDACYQDIAEQLLDDWINSNLDEGQYYADKQFAEMSGD |
⦗Top⦘ |