NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100438

Metagenome / Metatranscriptome Family F100438

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100438
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 64 residues
Representative Sequence DLEDRNLLQAKSLKLEKIMNEKMSKRRIQIKDLQKQEIEEKQERRLLIRLHIFYLILLINL
Number of Associated Samples 92
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 8.16 %
% of genes near scaffold ends (potentially truncated) 70.59 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.098 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(21.569 % of family members)
Environment Ontology (ENVO) Unclassified
(43.137 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(70.588 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 66.29%    β-sheet: 0.00%    Coil/Unstructured: 33.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00033Cytochrome_B 3.96
PF00032Cytochrom_B_C 0.99
PF00115COX1 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 4.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.10 %
UnclassifiedrootN/A4.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000134|BS_KBA_SWE07_21mDRAFT_c1039713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae516Open in IMG/M
3300000418|P_2C_Liq_1_UnCtyDRAFT_1061607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae636Open in IMG/M
3300000928|OpTDRAFT_10059605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae649Open in IMG/M
3300003807|Ga0007814_104191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae542Open in IMG/M
3300004806|Ga0007854_10336873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae620Open in IMG/M
3300005590|Ga0070727_10356359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae815Open in IMG/M
3300006086|Ga0075019_10880462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae574Open in IMG/M
3300006101|Ga0007810_1043003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae953Open in IMG/M
3300007512|Ga0105016_1297720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae538Open in IMG/M
3300007519|Ga0105055_10091504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae3186Open in IMG/M
3300007770|Ga0105015_1043030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2070Open in IMG/M
3300008932|Ga0103735_1064407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae552Open in IMG/M
3300008932|Ga0103735_1064407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae552Open in IMG/M
3300008934|Ga0103737_1053158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae518Open in IMG/M
3300008961|Ga0102887_1230468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae561Open in IMG/M
3300009265|Ga0103873_1025043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1022Open in IMG/M
3300009334|Ga0103841_1007580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae508Open in IMG/M
3300009436|Ga0115008_10931079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae644Open in IMG/M
3300009436|Ga0115008_11186512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae578Open in IMG/M
3300009436|Ga0115008_11418041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae535Open in IMG/M
3300009441|Ga0115007_10354518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae956Open in IMG/M
3300009441|Ga0115007_10775604Not Available647Open in IMG/M
3300009495|Ga0115571_1179266All Organisms → cellular organisms → Eukaryota → Sar875Open in IMG/M
3300009508|Ga0115567_10655216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae631Open in IMG/M
3300009526|Ga0115004_10959310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae512Open in IMG/M
3300009537|Ga0129283_10097753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1194Open in IMG/M
3300009544|Ga0115006_10466599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1106Open in IMG/M
3300009544|Ga0115006_11349404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae641Open in IMG/M
3300009606|Ga0115102_10634067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae739Open in IMG/M
3300010135|Ga0123382_1032583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae519Open in IMG/M
3300010309|Ga0102890_1130742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300010318|Ga0136656_1052370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1468Open in IMG/M
3300010430|Ga0118733_107008309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae586Open in IMG/M
3300012416|Ga0138259_1854359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae543Open in IMG/M
3300012417|Ga0138262_1428253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae677Open in IMG/M
3300012522|Ga0129326_1227298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae591Open in IMG/M
3300012954|Ga0163111_11332476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae705Open in IMG/M
3300012954|Ga0163111_11427474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae683Open in IMG/M
3300017730|Ga0181417_1172012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300018590|Ga0193114_1026441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae564Open in IMG/M
3300018667|Ga0193127_1033453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae596Open in IMG/M
3300018668|Ga0193013_1028457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae776Open in IMG/M
3300018676|Ga0193137_1060134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae546Open in IMG/M
3300018714|Ga0193349_1057999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae545Open in IMG/M
3300018726|Ga0194246_1042147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae730Open in IMG/M
3300018764|Ga0192924_1040894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae570Open in IMG/M
3300018791|Ga0192950_1010662All Organisms → cellular organisms → Eukaryota → Sar1084Open in IMG/M
3300018813|Ga0192872_1054410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae712Open in IMG/M
3300018901|Ga0193203_10238730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae588Open in IMG/M
3300018934|Ga0193552_10192917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae577Open in IMG/M
3300018951|Ga0193128_10038264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1083Open in IMG/M
3300018979|Ga0193540_10012794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1485Open in IMG/M
3300018979|Ga0193540_10173592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae600Open in IMG/M
3300018986|Ga0193554_10003101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2204Open in IMG/M
3300019008|Ga0193361_10170402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae821Open in IMG/M
3300019010|Ga0193044_10182833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae672Open in IMG/M
3300019039|Ga0193123_10114813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1035Open in IMG/M
3300019039|Ga0193123_10170962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae852Open in IMG/M
3300019055|Ga0193208_10704406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300019115|Ga0193443_1024201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae615Open in IMG/M
3300020141|Ga0211732_1066960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae669Open in IMG/M
3300020159|Ga0211734_10023786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae596Open in IMG/M
3300020161|Ga0211726_10039976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae500Open in IMG/M
3300020595|Ga0206126_10384634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae620Open in IMG/M
3300021913|Ga0063104_1104043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae560Open in IMG/M
3300022885|Ga0222662_1018011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1675Open in IMG/M
(restricted) 3300024052|Ga0255050_10099287All Organisms → cellular organisms → Eukaryota → Sar670Open in IMG/M
3300024250|Ga0228677_1087377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae608Open in IMG/M
3300024266|Ga0228661_1009042All Organisms → cellular organisms → Eukaryota → Sar1711Open in IMG/M
3300024346|Ga0244775_10630098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae868Open in IMG/M
3300024862|Ga0256317_1076014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae739Open in IMG/M
3300025466|Ga0208497_1050582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae833Open in IMG/M
3300025838|Ga0208872_1283038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae519Open in IMG/M
3300025869|Ga0209308_10313352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae651Open in IMG/M
3300025887|Ga0208544_10399395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae513Open in IMG/M
3300027251|Ga0208809_1079372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae520Open in IMG/M
3300027741|Ga0209085_1243260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum710Open in IMG/M
3300027752|Ga0209192_10350881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae519Open in IMG/M
3300027779|Ga0209709_10352007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae604Open in IMG/M
3300027780|Ga0209502_10253972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae779Open in IMG/M
3300027810|Ga0209302_10113014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1357Open in IMG/M
3300027833|Ga0209092_10263894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae944Open in IMG/M
3300027833|Ga0209092_10382759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae741Open in IMG/M
3300027833|Ga0209092_10436152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae680Open in IMG/M
3300027848|Ga0209390_10025977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae6056Open in IMG/M
(restricted) 3300027865|Ga0255052_10516760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae585Open in IMG/M
3300027906|Ga0209404_10287311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1046Open in IMG/M
3300028337|Ga0247579_1045138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae919Open in IMG/M
3300028396|Ga0228643_1151983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300028416|Ga0228614_1092485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae561Open in IMG/M
3300028419|Ga0228625_1080858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae669Open in IMG/M
3300031523|Ga0307492_10171976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae763Open in IMG/M
3300031566|Ga0307378_11028591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae668Open in IMG/M
3300031569|Ga0307489_11118215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae566Open in IMG/M
3300031628|Ga0308014_1056144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae962Open in IMG/M
3300032278|Ga0310345_12249906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae528Open in IMG/M
3300033978|Ga0334977_0208438All Organisms → cellular organisms → Eukaryota → Sar980Open in IMG/M
3300034072|Ga0310127_238922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae652Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.57%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater8.82%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.94%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.96%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.96%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.96%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.96%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.96%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.98%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.98%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.98%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.98%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.98%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.98%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.98%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.98%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.98%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.98%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.98%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.98%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.98%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.98%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.98%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000134Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21mEnvironmentalOpen in IMG/M
3300000418Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300003798Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07EnvironmentalOpen in IMG/M
3300003807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jun07EnvironmentalOpen in IMG/M
3300003818Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07EnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006101Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09EnvironmentalOpen in IMG/M
3300007512Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007770Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009334Microbial communities of water from the North Atlantic ocean - ACM46EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018667Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001334 (ERX1782401-ERR1711946)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018714Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985)EnvironmentalOpen in IMG/M
3300018726Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022885Saline water microbial communities from Ace Lake, Antarctica - #600EnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024250Seawater microbial communities from Monterey Bay, California, United States - 58D_rEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024862Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025339Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300028419Seawater microbial communities from Monterey Bay, California, United States - 30DEnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE07_21mDRAFT_103971313300000134MarineQAKSLKLEKIMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINL*
P_2C_Liq_1_UnCtyDRAFT_106160723300000418EnviromentalKLVHKDLEHRNLLQAKSLNLEKIMNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL*
OpTDRAFT_1005960513300000928Freshwater And MarineEHRNLLQSKSLKLEKIMNENMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0007842_101206213300003798FreshwaterETYYKIPLPSLGSPMLIHKDLEDRNLLLARLTLKLEKIMNEKKSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYRILLINL*
Ga0007814_10419113300003807FreshwaterLIHKDLEDRNLLLARLTLKLEKIMNEKKSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYRILLINL*
Ga0007841_10158313300003818FreshwaterSSNTNFTRANTSLGSPMLIHKDLEDRNLLLARLTLKLEKIMNEKKSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYRILLINL*
Ga0065168_104072613300004684FreshwaterYKIPLPSLGSPMLIHKDLEDRNLLLARLTLKLEKIMNEKKSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0007854_1033687313300004806FreshwaterMKLQKIIHKDLEHRNLSKNPQNLEKIMNEKMSKRRIQIIDFQKQEIEEKEETTLLIRLHIFYKILTINLCFKK*
Ga0070727_1035635923300005590Marine SedimentMLTTSCADRNLLQAMSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYQILLINL*
Ga0075019_1088046213300006086WatershedsMPIAQKLIHNDLEDRNLLQAKSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFY
Ga0007810_104300323300006101FreshwaterMKLQKIIHKDLEHRNLSKNPQNLEKIMNEKMSKRRIQIIDFQKQEIEEKEEATLLIRLHIFYKILLINLCTKN*
Ga0105016_129772013300007512MarineKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0105055_1009150433300007519FreshwaterDLEDRNLLQAKSLKLEKIMNEKMSKRRIQIKDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0105015_104303033300007770MarineKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL*
Ga0103735_106440713300008932Ice Edge, Mcmurdo Sound, AntarcticaQKLIHKDLEHRNLLQSKSLKLEKIMNENMSKRRIQITDLQKQEIEEKQNKRLLIRSLQRFEK*
Ga0103735_106440723300008932Ice Edge, Mcmurdo Sound, AntarcticaQKLIHKDLEHRNLLQSKSLKLEKIMNENMSKRRIQITDLQKQEIEEKQNKRLLIRSLQRFGKDYKILER*
Ga0103737_105315813300008934Ice Edge, Mcmurdo Sound, AntarcticaNLLQAKSLNLKKIMNEMMPKRRIQITDLQKQEIEEKQEIRPLIRLHIFYLILLINL*
Ga0102887_123046813300008961EstuarineHRNLLQAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0103873_102504313300009265Surface Ocean WaterHRNLQQAKSLNLEKIMNEEMPKRRIEITELQKQEIEKKQEIRPLIRFHIFYLILLINL*
Ga0103841_100758013300009334River WaterNLLQAMSLKLVKIMNEMMPKRRIQIRELQKQEIEKKQERGPLIRFHIF*
Ga0115008_1093107913300009436MarineDLEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEETKERRLLIRLHIFSQILLINL*
Ga0115008_1118651213300009436MarineLLQAKSLNLEKIMNEKMSKRRIQITDLHSQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0115008_1141804113300009436MarineDLEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL*
Ga0115007_1035451813300009441MarineMDLEDRKLLLATSLKLVKIMNEKMSKRMIQIIELQRLEHHQKEERRLLIRFHIFSVILLINLYTKNEN*
Ga0115007_1077560413300009441MarineEHRNLLQDKSLKMEKIMNEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL*
Ga0115571_117926623300009495Pelagic MarineLQAKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0115567_1065521613300009508Pelagic MarineLEHRNLLQAKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLINL
Ga0115004_1095931033300009526MarineLEHRNLLQAKSLNLEKIMNEKMSKRRIQITDLHSQEIEEKQEIRLLIRLHIFYLILLINL
Ga0129283_1009775313300009537Beach Aquifer PorewaterVYLKKLIHKDLEDRNLLHAKSLKLERIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYPILLINL*
Ga0115006_1046659913300009544MarineIHKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL*
Ga0115006_1134940413300009544MarineLLQDKSLNLEKIMNEKTSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0115102_1063406733300009606MarineAKSLNLEKIMNEKMSKKRIQIRDLQKQEIEKKQETRPLIRLHIFYLILLINL*
Ga0123382_103258313300010135MarineMPFLGYIISLSWDLLEDRNLLQAKSLNLEKMMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN*
Ga0102890_113074213300010309EstuarineLEHRNLLQAKSLNLEKIMNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL
Ga0136656_105237023300010318Freshwater To Marine Saline GradientVYLKKLIHKDLEDRNLLLDKSLKLEKIMNEKMSKRRIQITDLQKEEIEETQERRLLIRLHIFYQILLINL*
Ga0118733_10700830923300010430Marine SedimentMLTTSCADRNLLQAMSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL*
Ga0138259_185435913300012416Polar MarineKLIHKDLEHRNLLQAKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL*
Ga0138262_142825313300012417Polar MarineKDLEHRNLLQAKSLKLEKMMNEKMSKRRIQIIDLQKREIEEKRERRLLIRLHIFYLILLINL*
Ga0129326_122729813300012522AqueousMEDRNLLQDKSQKLVKIMNEKISKRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINLCVKNEK*
Ga0163111_1133247613300012954Surface SeawaterLEHRNLLLAKSLNLEKIMNEKMSKRRIQIRDLQKQEIEEKRERRLLIRLHIFYLILLINL
Ga0163111_1142747413300012954Surface SeawaterRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL*
Ga0181417_117201213300017730SeawaterLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL
Ga0193114_102644123300018590MarineMDLEDRNLHQAKILKLGKIMNEKMSKRRIQIRDLQKQEIEKKQERGPLIRLHIF
Ga0193127_103345313300018667MarineMDLEDRNLHQAKILKLGKIMNEKMSKRRIQIRDLQKQEIEEIQEIKLLIRLHIFYLILL
Ga0193013_102845733300018668MarineMDLEDRNLHQAKILKLGKIMNEKMSKRRIQIRDLQKQEIEEIQGRGPLIRLHIY
Ga0193137_106013413300018676MarineNLLQAKSLKLEKIMNEKMSKRRIQITDLQKQEIEEKQERGPLIRLHIFYQILLINL
Ga0193349_105799913300018714MarineLIHKDLEHRNLLLAKSLNLEKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL
Ga0194246_104214733300018726MarineMDLEDRNLHQAKILKLGKIMNEKMPKRRIQIRDLQKQEIEEKQERGPLIRLHIF
Ga0192924_104089413300018764MarineIHKDLEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0192950_101066223300018791MarineVSEKDLEDRNLLLDKSLKLEKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHILYQILLINSRNS
Ga0192872_105441023300018813MarineMLIQKDLEDRNLLQEKSLKLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYKILLINL
Ga0193203_1023873013300018901MarineNLLQAKSLKLQKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFRALPFLVTP
Ga0193552_1019291713300018934MarineNLLEGKSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFRALPSPGL
Ga0193128_1003826413300018951MarineMLIQKDLKNRNLLQEKSLKLEKIMNEKMSKRRIQITDLQKQEIEETKERRLLIRLHIFYQILLINLC
Ga0193540_1001279433300018979MarineMEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0193540_1017359213300018979MarineRNLLQEKSLKLEKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL
Ga0193554_1000310113300018986MarineNLLQAKSLKLEKIMNEKMSKRRIQITDLQKQEIEETKERRLLIRLHIF
Ga0193361_1017040213300019008MarineMDLEDRNLHQAKILKLGKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINLWTKNEKKTKGS
Ga0193044_1018283313300019010MarineHKDLGHRNLLQAKSLKLEKKMNEKLSKRRIQIIDLQKKEIEEKQEIRLLIRLHIFYLILIFNY
Ga0193123_1011481323300019039MarineMLVQKDLEDRNLLQEKSLKLEKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL
Ga0193123_1017096213300019039MarineIHKDLEDRNLLQAKSLKLKKIMNEKMPKRRIQITDLQKQEIEGKQERRLLIRLHIFYLILLINL
Ga0193208_1070440623300019055MarineMDLEDRNLHQAKILKLGKIMNEKMPKRRIQIRDLQKQEIEKIQEIKPLIRFHIF
Ga0193443_102420113300019115MarineIHKDLEDRNLLQAKSLKLEKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0211732_106696023300020141FreshwaterMDLVDRKLLLATSLKLVKIKSEKMSKRMIQIIELQRLEHHQKEERRLLIRFHIFSVILLINLYTKNEY
Ga0211734_1002378613300020159FreshwaterRITRQSKLIHMDLVDRKLLLATSLKLVKIKSEKMSKRMIQIIELQRLEHHQKEERRLLIRFHIFSVILLINLYTKNEY
Ga0211726_1003997613300020161FreshwaterMLVDLVDRKLLLATSLKLVKIKSEKMSKRMIQIIELQRLEHHQKEERRLLIRFHIFSVILLINLYTKNEY
Ga0206126_1038463413300020595SeawaterLEHRNLLLAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLINL
Ga0063104_110404313300021913MarineLEHRNLLQAKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0222662_101801123300022885Saline WaterMSFGINLQVLRNKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
(restricted) Ga0255050_1009928713300024052SeawaterLNSYYVRIWPWRRKLIHKDLEDRNLLQAMSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL
Ga0228677_108737723300024250SeawaterKDLEHRNLLQAKSQNLEKQMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0228661_100904233300024266SeawaterIFRNLLLNKSLKMEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL
Ga0244775_1063009823300024346EstuarineIDKDLEDRNLQQAKSLKLEQIMNEKMSKRRIQIIVLQKQEIEEKEERRLLITLHIFYLILLINL
Ga0256317_107601423300024862FreshwaterGQTKSLKLEQIMNEKMSKRRIQIIVLQKQEIEEKEERRPLITHHIFYEILLINL
Ga0208502_101019113300025339FreshwaterMNVETYYKIPLPSLGSPMLIHKDLEDRNLLLARLTLKLEKIMNEKKSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYRILLINL
Ga0208497_105058223300025466FreshwaterKIIHKDLEHRNLSKNPQNLEKIMNEKMSKRRIQIIDLQKQEIEEKEEATLLIRLHIFYKILLINLCTKN
Ga0208872_128303813300025838FreshwaterMKLQKIIHKDLEHRNLSKNPQNLEKIMNEKMSKRRIQIIDFQKQEIEEKEETTLLIRLHIFYKILTINLCFKK
Ga0209308_1031335223300025869Pelagic MarineDLEHRNLLLAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLIN
Ga0208544_1039939513300025887AqueousNKFEHKDLEHRNLPLAKSLNLEKIMNEKMSKKRIQIRDLQKQEIEEKQETRLLIRLHIFYKILLINL
Ga0208809_107937213300027251EstuarineEHRNLLQAKSLNLKKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0209085_124326013300027741Freshwater LakeKKIIKYSLKEKIIHKDLEHRNLSKNPQNLEKIMNEKMSKRRIQIIDFQKQEIEEKEETTLLIRLHIFYKILTINLCFKK
Ga0209192_1035088113300027752MarineKDLEHRNLLLAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLINL
Ga0209709_1035200713300027779MarineEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL
Ga0209502_1025397223300027780MarineKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL
Ga0209302_1011301423300027810MarineMKFTWKKAYRNLLQDKSLNLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL
Ga0209092_1026389413300027833MarineHKDLEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0209092_1038275923300027833MarineHKDLEDRNLLQAKSLKLKKIMNEKMSKRRIQITDLQKQEIEETKERRLLIRLHILSQILLINL
Ga0209092_1043615213300027833MarineLIHKDLEHRNLLQTKSLNLEKMMNEKKSKRRIRIIDLQKRERQEKQERRLLIRLHIFYLILLINL
Ga0209390_1002597783300027848FreshwaterDRNLQQAKSLMLEQIMNERMSKRRIQIIVLQKQEIEEKEERRLLITLHIFYLILLINL
(restricted) Ga0255052_1051676013300027865SeawaterSFSFHVRIWPWRRKLIHKDLEDRNLLQAMSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL
Ga0209404_1028731113300027906MarineLIHKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL
Ga0247579_104513813300028337SeawaterPLAKSLNLEKIMNEKMSKKRIQIRDLQKQEIEEKRERRLLIRLHIFYKILLINL
Ga0228643_115198313300028396SeawaterISRHGGAIRISFNIIRNLLLNKSLKMEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL
Ga0228614_109248513300028416SeawaterEGNNDESKDLEHRNLLQAKSQNLEKQMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0228625_108085823300028419SeawaterNNDESKDLEHRNLLQAKSQNLEKQMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0307492_1017197613300031523Sea-Ice BrineKLIHKDLEDRNLLQAKSLKLEKIMNEKMSKRRIQIKDLQKQEIEEKQERRLLIRLHIFYLILLINL
Ga0307378_1102859123300031566SoilDLEDRKLLQAKSLKLEKIMNEKMSKRRIQIRELQKQELPQKEERRLLIRLHIFYIILLINLLTKNEN
Ga0307489_1111821513300031569Sackhole BrineMDLEDRKLLLATSLKLVKIMNEKMSKRMIQIIELQRLEHHQKEERRLLIRFHIFSVILLINLYTKNEN
Ga0308014_105614413300031628MarineLIHKDLEHRNLQQAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL
Ga0310345_1224990613300032278SeawaterVYLQKLIHKDLEDRNLLQAKSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKEERRLLIRLHIFYLILLINL
Ga0334977_0208438_769_9783300033978FreshwaterHKDLEDRNLLLAKSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINLYTKNEN
Ga0310127_238922_473_6523300034072Fracking WaterEDRNLLQAKSLKLKKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.