NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100456

Metagenome Family F100456

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100456
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 47 residues
Representative Sequence MGKTSSGRPRWIGIPARVFAMTFLLTLLSFAVALLLSILGTVVYSQVKH
Number of Associated Samples 90
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 24.51 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 85.29 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(10.784 % of family members)
Environment Ontology (ENVO) Unclassified
(38.235 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.157 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.65%    β-sheet: 0.00%    Coil/Unstructured: 49.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF05163DinB 4.90
PF05016ParE_toxin 2.94
PF00903Glyoxalase 2.94
PF03544TonB_C 2.94
PF09720Unstab_antitox 2.94
PF04389Peptidase_M28 1.96
PF01022HTH_5 1.96
PF00989PAS 0.98
PF00106adh_short 0.98
PF13847Methyltransf_31 0.98
PF05977MFS_3 0.98
PF07238PilZ 0.98
PF12770CHAT 0.98
PF08327AHSA1 0.98
PF00464SHMT 0.98
PF05988DUF899 0.98
PF12681Glyoxalase_2 0.98
PF08241Methyltransf_11 0.98
PF04185Phosphoesterase 0.98
PF02769AIRS_C 0.98
PF13365Trypsin_2 0.98
PF07732Cu-oxidase_3 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 4.90
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 2.94
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.98
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.98
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.98
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.98
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.98
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.06 %
UnclassifiedrootN/A2.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10330235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300001593|JGI12635J15846_10048452All Organisms → cellular organisms → Bacteria3256Open in IMG/M
3300004152|Ga0062386_101244159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300004635|Ga0062388_100336623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1279Open in IMG/M
3300005445|Ga0070708_100627999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300005445|Ga0070708_100658191Not Available987Open in IMG/M
3300005468|Ga0070707_100109768All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300005568|Ga0066703_10237945All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300005586|Ga0066691_10227103All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300005995|Ga0066790_10113083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1165Open in IMG/M
3300006059|Ga0075017_100215047All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300006059|Ga0075017_100524826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300006102|Ga0075015_100824607All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300007258|Ga0099793_10332017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300009519|Ga0116108_1033915All Organisms → cellular organisms → Bacteria → Acidobacteria1675Open in IMG/M
3300009621|Ga0116116_1078217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium936Open in IMG/M
3300009630|Ga0116114_1013520All Organisms → cellular organisms → Bacteria2565Open in IMG/M
3300009630|Ga0116114_1145735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300009643|Ga0116110_1296046All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300009644|Ga0116121_1278221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300009645|Ga0116106_1265459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300009683|Ga0116224_10358405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300009700|Ga0116217_10809940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009700|Ga0116217_10981492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300009764|Ga0116134_1048270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1635Open in IMG/M
3300010379|Ga0136449_103223676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300010379|Ga0136449_104207787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300012350|Ga0137372_10437682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300012354|Ga0137366_10227399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1388Open in IMG/M
3300012925|Ga0137419_11666191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300012929|Ga0137404_12300245All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300014159|Ga0181530_10010048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8392Open in IMG/M
3300014160|Ga0181517_10696787All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300014162|Ga0181538_10202877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1112Open in IMG/M
3300014162|Ga0181538_10321149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300014164|Ga0181532_10753191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300014167|Ga0181528_10384052All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300014169|Ga0181531_10880490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300014200|Ga0181526_10055678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2521Open in IMG/M
3300014200|Ga0181526_10136469All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300014200|Ga0181526_11022155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300014491|Ga0182014_10385934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300014491|Ga0182014_10508243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7590Open in IMG/M
3300014498|Ga0182019_10483106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300014502|Ga0182021_11379475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300014638|Ga0181536_10113280All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1507Open in IMG/M
3300015167|Ga0167661_1026989All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300017822|Ga0187802_10129831All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300017933|Ga0187801_10015275All Organisms → cellular organisms → Bacteria2557Open in IMG/M
3300017955|Ga0187817_10032901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3148Open in IMG/M
3300017955|Ga0187817_10131680All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1585Open in IMG/M
3300017975|Ga0187782_10218743All Organisms → cellular organisms → Bacteria → Acidobacteria1428Open in IMG/M
3300018014|Ga0187860_1227926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300018016|Ga0187880_1002621All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13959Open in IMG/M
3300018016|Ga0187880_1316527All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300018024|Ga0187881_10447179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300018037|Ga0187883_10766893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300018038|Ga0187855_10569737All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300018085|Ga0187772_10998425All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300018086|Ga0187769_10701593All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300019877|Ga0193722_1105868All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300021170|Ga0210400_10324348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1266Open in IMG/M
3300022521|Ga0224541_1023551All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300024295|Ga0224556_1164009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300025419|Ga0208036_1030141All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300025444|Ga0208189_1041177Not Available901Open in IMG/M
3300025922|Ga0207646_11663893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300026273|Ga0209881_1038285All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300026341|Ga0257151_1027493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300026469|Ga0257169_1026654All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300027045|Ga0207726_1046759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300027297|Ga0208241_1077399All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300027432|Ga0209421_1124416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300027546|Ga0208984_1096282All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300027562|Ga0209735_1075623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300027692|Ga0209530_1008631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3225Open in IMG/M
3300027729|Ga0209248_10223070Not Available553Open in IMG/M
3300027737|Ga0209038_10191264All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300027745|Ga0209908_10128207All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300027908|Ga0209006_10812276All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300028069|Ga0255358_1015511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1049Open in IMG/M
3300028574|Ga0302153_10052656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1365Open in IMG/M
3300028747|Ga0302219_10117576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1010Open in IMG/M
3300028870|Ga0302254_10335135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300028882|Ga0302154_10193674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300029916|Ga0302148_1014246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2358Open in IMG/M
3300029954|Ga0311331_10131520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3065Open in IMG/M
3300029982|Ga0302277_1095793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300029990|Ga0311336_11469052All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300030049|Ga0302191_10088138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300030053|Ga0302177_10199535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1103Open in IMG/M
3300030524|Ga0311357_10635732All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300031233|Ga0302307_10542161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300031236|Ga0302324_100266451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2657Open in IMG/M
3300031525|Ga0302326_10043644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8687Open in IMG/M
3300031525|Ga0302326_13274926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300031823|Ga0307478_10596861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300032782|Ga0335082_11542035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300032955|Ga0335076_10523281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1069Open in IMG/M
3300033486|Ga0316624_10093341All Organisms → cellular organisms → Bacteria → Acidobacteria2097Open in IMG/M
3300033982|Ga0371487_0025127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3953Open in IMG/M
3300034091|Ga0326724_0129615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1597Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog10.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.86%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026341Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-AEnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1033023513300001356Peatlands SoilMAKTSSDGPRWIGIPARVFAMTFLFTALSFAIALLLSIMGTMVYSQVRHVAPNL
JGI12635J15846_1004845263300001593Forest SoilMAKTASDGPLWIGIPVRAFAMTFLFTVLSFAVALLLSILGSVVY
Ga0062386_10124415923300004152Bog Forest SoilMAKPSSDGPRWIGIPARVFAMTFLFTLLSFAIALLLSILGAVVYSQVKHVAPNLTFAYRH
Ga0062388_10033662333300004635Bog Forest SoilMVNTSSSGPRWIGIPARVFAMTFLFTVLSFAVALLLSILG
Ga0070708_10062799923300005445Corn, Switchgrass And Miscanthus RhizosphereMPGTTSGRPRWIGIPLRVLLMTALLTLLAFAVSLLLSILGTVVYSQVKHVAPNM
Ga0070708_10065819123300005445Corn, Switchgrass And Miscanthus RhizosphereMGKTSSGGPRWTGIPVRVLAMTFLLTLLSFAVALLLSILGT
Ga0070707_10010976813300005468Corn, Switchgrass And Miscanthus RhizosphereMGKTSSGRPRWIGIPARVFAMTFLLTLLSFAVALLLSILGTVVYSQVKH
Ga0066703_1023794543300005568SoilMGKTSSGGPRWIGIPARVLAMTFLLTLLSFAVALLLSILGTVVYSQVKHVAP
Ga0066691_1022710343300005586SoilMGKTSSGGPRWIGIPARVLAMTFLFTLLSFAVALLLSILGTVVYSQVKHVAPNL
Ga0066790_1011308333300005995SoilMAKTNSDGPRWIGIPVRVFALTFLLTLLSFAVALLLSIMGTVVYSQMKHVA
Ga0075017_10021504713300006059WatershedsMPKTESTRLRWIGIPVRAFALTFLLTLLSFAVALLLSILGTIVYSQIQH
Ga0075017_10052482613300006059WatershedsMLSRTSPRWIGIPFRVFAITFLLTLLSFAVALLLSILGTIVYSQVKHVAPN
Ga0075015_10082460723300006102WatershedsMAKTNSDGLRWIGIPARVFAMTFLFTVLSFAVALLLSILGTVVY
Ga0099793_1033201713300007258Vadose Zone SoilMPQTTSGRPRWVGIPLRVLLTTAVVTLLAFAVSLLLSILGTVVYSQVQHVAPNMPFA
Ga0116108_103391533300009519PeatlandMNMAKTSSDGPRWIGIPARVFAITFLLTLLSFAVALLLSIMGTVVYSQVKH
Ga0116116_107821723300009621PeatlandMNMAKTSSDGPRWIGIPARVFAITFLLTLLSFAVALLLSIMGTVVYSQVK
Ga0116114_101352013300009630PeatlandMARTSSDGPRWIGIPARVFAVTFLITLLSFAVALLLSIVGIVVYSQVKHVAPNLTFA
Ga0116114_114573523300009630PeatlandMTMAKTSSDGPRWIGIPARVFAVTFLLTLLSFAVALLLSIMGT
Ga0116110_129604613300009643PeatlandMGRTSSDGPRWIGIPARVFLMTFLLTLLSFAIALL
Ga0116121_127822113300009644PeatlandMGKKGSEGPRWIGIPARVFAMTFLFTLLAFAVALLLSILGTVVYSQVKH
Ga0116106_126545913300009645PeatlandMAQTGSGGLRWIGIPARVFAMTFLFTLLSFAVALLLSIM
Ga0116224_1035840523300009683Peatlands SoilMGETSSDGPRWIGIPARVFAMTFLSTLLSFAIALLLSIMGTVVYSQVRHVAPN
Ga0116217_1080994013300009700Peatlands SoilMAKLSSDGPRWIGIPARVFAMTFLLTLLSFAVALL
Ga0116217_1098149223300009700Peatlands SoilMAQTSSGGLRWIGIPARVFAMTFLFTLLSFAVALLLSIMGTVVYSQVKHVAPNLTFAY
Ga0116134_104827013300009764PeatlandMSMAKTSSDGPRWIGIPARVFATTFLLTLLSFAVALLL
Ga0136449_10322367623300010379Peatlands SoilMAKASSGGPRWIGIPARVFAMTFLFTLLSFAVALLLSIMGTVVYAQVKHVAPNLTF
Ga0136449_10420778713300010379Peatlands SoilMGETSSGGPRWIGIPMRVFAMTFLFTALSFAIALLL
Ga0137372_1043768213300012350Vadose Zone SoilMAQTSSSQPRWTGIPFRVLAVTILLTLLAFAIALLLGILGTVV
Ga0137366_1022739913300012354Vadose Zone SoilMASSKSARPRWIGIPFRVLAVTLLLTLLSFAVALLLSILGTIVYARGSGTS
Ga0137419_1166619123300012925Vadose Zone SoilMSQTVSQQPRWVGIPVRVVLTTVVVTLLAFAVGLLLSILGTVVYSQVKHVAP
Ga0137404_1230024513300012929Vadose Zone SoilMEKAGSVARWIAVPARVVAITFLFTLLSFAVALLLSILGTVVYSQVKHVA
Ga0181530_10010048103300014159BogMGRTSSDGPRWIGIPARVFLMTFLLTLLSFAIALLLSILG
Ga0181517_1069678723300014160BogMLKSGLTRRRWLGIPARVFGFTFLLTLLSFAVALLLSILGTIIYAEV
Ga0181538_1020287713300014162BogMAKTSSDGPRWIGIPVRVFAMTFLLTLLSFAIALLLS
Ga0181538_1032114913300014162BogMAKTSSDGPRWIGIPARVFAMTFLFTVLSFAVALLLS
Ga0181532_1075319123300014164BogMAKTSSDGPRWIGIPVRVFAMTFLLTLLSFAIALLL
Ga0181528_1038405223300014167BogMLKSGSTRRRWLGIPARVFGFTFLLTLLSFAVALLLSILGTIIYAEVEHLP
Ga0181531_1088049013300014169BogMLKSGSTRRRWLGIPARVFGFTFVLTLLSFAVALLLSILGTIIYAEVEHLPPN
Ga0181526_1005567813300014200BogMAKTSSDGPRWIGIPVRVFAMTFLLTLLSFAIALLLSILGMVVYSQVKHVAPNLTFAYR
Ga0181526_1013646913300014200BogMSMAKTSSDGPRWIGIPARVFAMTFLFTLLSFAVAL
Ga0181526_1102215513300014200BogMTMAKTSSDGPRWIGIPARVFAMTFLFTLLSFAVALLLSIM
Ga0182014_1038593423300014491BogMAKTSSDGPRWIGIPARVFAMTFLLTLLSFAVALLLSI
Ga0182014_1050824313300014491BogMTMAKTSSEGPRWIGIPARVFAVTFLLTLLSFAVA
Ga0182019_1048310623300014498FenMSMAKTNSDGPRWIGIPARVFAMTFLLTLLSFAVALLLSVMGIVVYSQMKHVAPNLAFAY
Ga0182021_1137947523300014502FenMAKTSSDGPRWIGIPARVFAMTFLLTLLSFAVALLLSIMGTVIYSQMKHVAPNL
Ga0181536_1011328013300014638BogMAKTSSDGPRWIGIPARVFAMTFLFTALSFAVALLLSIMGTVVYSQVRH
Ga0167661_102698913300015167Glacier Forefield SoilMAKTSSDGPRWIGIPVRVFAMTFLLTLLSFAVALLLSIMGTVV
Ga0187802_1012983133300017822Freshwater SedimentMANPSLDGPRWIGIPVRVFAMTFLLTLLSFAIALLLSILGTVVYSQVK
Ga0187801_1001527533300017933Freshwater SedimentMPSSESKQPRWIGIPFRVFAVTFLLTVLSFAVALLLSILG
Ga0187817_1003290113300017955Freshwater SedimentMSKTASARPRWIGIPFRVFAVTFLLTLLSFAVALLLSILGTIVYSQVE
Ga0187817_1013168013300017955Freshwater SedimentMGKTGSNGLRWIGVPARVFAMTFLFTLLSFAVALLLS
Ga0187782_1021874333300017975Tropical PeatlandMAESNAGRPGWIGVPVRALLVTFLFTLLSFAVALLLSILGTVVYSQVE
Ga0187860_122792613300018014PeatlandMAKTSSDGPRWIGIPARVFAITFLSTLLSFAVALLLSIMGTVVYSQVRHVAPNL
Ga0187880_100262113300018016PeatlandMARTSSDGPRWIGIPARVFAVTFLITLLSFAVALLLSIVGIVVYSQVKHV
Ga0187880_131652723300018016PeatlandMAKTSSDGPRWIGIPARVFAITFLSTALSFAVALLLSIMGTVVYSQVRHVAP
Ga0187881_1044717913300018024PeatlandMAKTSSDGPRWIGIPARVFAMTFLLTLLAFAVALLLSIMGTVVYSQVRHV
Ga0187883_1076689313300018037PeatlandMGETSSDGPRWIGIPARVLAMTFLSTLLSFAIALLLSIM
Ga0187855_1056973723300018038PeatlandMATTTSDGPRWIGIPARVVAMTLLLTLLSFAIALLLSIMGTVVYSQVK
Ga0187772_1099842523300018085Tropical PeatlandMLKAESERPRWIGVPVRALAVTFLLTLLSFAVALLLSILGTVVYSQVEHVAPPLQFAY
Ga0187769_1070159313300018086Tropical PeatlandMARAETPRLRWIGVPVRALAVTFLFTLLSFAVALLLSILGTVVYSQVEHVAPNLPFAYR
Ga0193722_110586823300019877SoilVAEEIPKPRWIGIPLRAVAVTFLFTVLSFAVALLLSILGTIVYSQVKH
Ga0210400_1032434833300021170SoilMAKRSSGGPRWIGIPARVFAMTFLLTVLSFAVALL
Ga0224541_102355123300022521SoilMAQTSSEGPRWIGIPVRVFAMTFLFTVLSFAVALLLSILGTVVYSQVKHVAPNLTFAYRH
Ga0224556_116400923300024295SoilMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILGTVVYSQVK
Ga0208036_103014113300025419PeatlandMNMAKTSSDGPRWIGIPARVFAITFLLTLLSFAVA
Ga0208189_104117713300025444PeatlandMARTSSDGPRWIGIPARVFAVTFLITLLSFAVALLLSIVGIVVYSQVKHVAPNLTF
Ga0207646_1166389313300025922Corn, Switchgrass And Miscanthus RhizosphereMGKTSSGRPRWIGIPARVFAMTFLLTLLSFAVALLLSILGTVVYSQ
Ga0209881_103828533300026273SoilMGKTGSNGLRWIGIPVRAFAMTFLFTLLSFAVALLLSILGTMVY
Ga0257151_102749313300026341SoilMPQTISARPRWIGIPVRVLLTTVVVTLLAFAVSLLLSILGTVVYSQVKHVAPNMPYAYRY
Ga0257169_102665433300026469SoilMAKRSSGGPRWIGIPARVFAMTFLLTVLSFAVALLVSILGT
Ga0207726_104675913300027045Tropical Forest SoilMPEASSNQPRWITIPFSVLAVTFLLTLLSFAVALLLSILGSIVY
Ga0208241_107739923300027297Forest SoilMAKTGAGGPRWVGIPVRVFAMTFLFTVLSFAVALLLSILGTVVYSQV
Ga0209421_112441613300027432Forest SoilMARTTSDGPRWIGIPARVFAMTFLFTLLSFAVALLLSILGTVVYSQVKHVAPNLTFA
Ga0208984_109628223300027546Forest SoilMGKASSGGPRWIGIPARVFALTFLLTLLSFAVALLLSILGTVVYS
Ga0209735_107562313300027562Forest SoilMAKRSSGGPRWIGIPARVFAMTFLLTVLSFAVALLVSILGTVVYS
Ga0209530_100863113300027692Forest SoilMARTTSDGPRWIGIPARVFAMTFLFTLLSFAIALLLSILGTVVYSQVKHVAP
Ga0209248_1022307023300027729Bog Forest SoilMAKADSSGPRWIGIPARVFAMTFLFTLLTFAVALLLSILGT
Ga0209038_1019126413300027737Bog Forest SoilMADTSSSRLGWMLIPARVFAMTFLFTLLSFAVALLLS
Ga0209908_1012820713300027745Thawing PermafrostMGKTSSDGPRWIGIPARAFAMTFLFTLLSFAIALLLSILGTVVYSQVKHVAPNLTFA
Ga0209006_1081227623300027908Forest SoilMPRTEVERPRLIGIAARVLAFTVLGTLLSFAVALLLSILGTVIYSRIEHVAPN
Ga0255358_101551123300028069SoilMSMAKTSSDGPRWIGIPARVFAMTFLLTLLSFAVALLLSIMGTVIY
Ga0302153_1005265633300028574BogMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILGTVVYSQVKHVAP
Ga0302219_1011757613300028747PalsaMAETVSDGPRWIGIPARVIALTFLLTLLSFAVALLLSILGTVVYSQVKHVAPNLT
Ga0302254_1033513513300028870FenMPEAISSRPRWIAIPFRVLLMTSLLTLLAFAVALLLSILGTIVYSQVEHVAP
Ga0302154_1019367423300028882BogMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILG
Ga0302148_101424613300029916BogMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILGTVVY
Ga0311331_1013152013300029954BogMGKTNADGAGWIGVPVRVVAMTFLFTVLSFAVALLLSILGT
Ga0302277_109579313300029982BogMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILGTVVYSQVKH
Ga0311336_1146905223300029990FenMSMAKTSSDGPRWIGIPARVFAMTFLLTLLSFAVALLLSIMGTVIYSQMKHVAPNL
Ga0302191_1008813823300030049BogMGKTNADGPRWIGIPFRVFAMTFLLTLLSFAVALLLSILGTVVYSQVKHVAPNL
Ga0302177_1019953513300030053PalsaMAKASSEGPRWILIPARVFAMTFLFTLLSFAVALLL
Ga0311357_1063573233300030524PalsaMAKTGSDRPRWIGIPARVFVFTFLFTVLTFAVALLLSILGTVVYSQVKHV
Ga0302307_1054216113300031233PalsaVGKTSSDGLRWIGIPARAFAMTFLFTLLSFAVALLLGILGTVVYSQVKHVAPNLTFAYR
Ga0302324_10026645153300031236PalsaMAETVSDGPRWIGIPARVIALTFLLTLLSFAVALLLSILGTVVYSQVKHV
Ga0302326_1004364483300031525PalsaMAQTSSEGPRWIGIPVRVFAMTFLFTVLSFAVALLLSILGTVVYSQVKHV
Ga0302326_1327492613300031525PalsaMAKSASNGPRWIGIPARVFAMTFLFTLLSFAVALLLSILGTVVY
Ga0307478_1059686113300031823Hardwood Forest SoilMAKTTSDAPRWIGIPARVFAMTFLLTVLSFAVALLL
Ga0335082_1154203523300032782SoilMPKANSDRPRWTGIPVRVVLMTALFTLLAFAVSLLLSILGTLVYS
Ga0335076_1052328113300032955SoilMAGSETGRPRWIGIPVRALLVTFLLTLLSFAVALLLSILGTIVYSQVEHVAPNLPFAYR
Ga0316624_1009334143300033486SoilMGKTGSNGLRWIGIPVRAFAMTFLFTLLSFAVALLLSIL
Ga0371487_0025127_3778_39513300033982Peat SoilMANAGSARPGWIGVPVRALLVTFLFTLLSFAVALLLSILGTVVYSQVVHVAPNLQYAY
Ga0326724_0129615_1_1443300034091Peat SoilMAKTSSDGPRWIGIPVRVFAVTFLLTLLSFAIALLLSIMGTVVYSQMK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.