Basic Information | |
---|---|
Family ID | F100840 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | AGDIAGLLANAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.18 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.216 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (33.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.588 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.529 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF04055 | Radical_SAM | 15.69 |
PF13520 | AA_permease_2 | 2.94 |
PF00072 | Response_reg | 2.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.22 % |
Unclassified | root | N/A | 10.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002561|JGI25384J37096_10021579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2510 | Open in IMG/M |
3300002562|JGI25382J37095_10130605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 844 | Open in IMG/M |
3300002911|JGI25390J43892_10033365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1241 | Open in IMG/M |
3300002916|JGI25389J43894_1108821 | Not Available | 502 | Open in IMG/M |
3300005166|Ga0066674_10168615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1037 | Open in IMG/M |
3300005171|Ga0066677_10258838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 989 | Open in IMG/M |
3300005178|Ga0066688_10162136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1405 | Open in IMG/M |
3300005178|Ga0066688_10861359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
3300005179|Ga0066684_10084188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1914 | Open in IMG/M |
3300005179|Ga0066684_10170113 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1394 | Open in IMG/M |
3300005186|Ga0066676_10051283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2346 | Open in IMG/M |
3300005447|Ga0066689_10795555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 588 | Open in IMG/M |
3300005451|Ga0066681_10833333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
3300005540|Ga0066697_10477935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
3300005552|Ga0066701_10028461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2878 | Open in IMG/M |
3300005553|Ga0066695_10092612 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1847 | Open in IMG/M |
3300005553|Ga0066695_10829738 | Not Available | 531 | Open in IMG/M |
3300005556|Ga0066707_10205388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1272 | Open in IMG/M |
3300005558|Ga0066698_10492867 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300005560|Ga0066670_10663097 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 633 | Open in IMG/M |
3300005561|Ga0066699_10247687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1257 | Open in IMG/M |
3300005566|Ga0066693_10279898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300005576|Ga0066708_10543636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
3300005587|Ga0066654_10741671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300006034|Ga0066656_10958462 | Not Available | 548 | Open in IMG/M |
3300006034|Ga0066656_11105409 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300006794|Ga0066658_10108339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1331 | Open in IMG/M |
3300006797|Ga0066659_10106405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1919 | Open in IMG/M |
3300007258|Ga0099793_10476510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300007265|Ga0099794_10316003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 810 | Open in IMG/M |
3300009012|Ga0066710_102756338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 698 | Open in IMG/M |
3300009012|Ga0066710_103462198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
3300009012|Ga0066710_104886626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300009088|Ga0099830_10504060 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 988 | Open in IMG/M |
3300009089|Ga0099828_10281530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1494 | Open in IMG/M |
3300009089|Ga0099828_10552773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1037 | Open in IMG/M |
3300009137|Ga0066709_100287808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2224 | Open in IMG/M |
3300009137|Ga0066709_100386446 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300009147|Ga0114129_12438177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
3300010304|Ga0134088_10273457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
3300010304|Ga0134088_10488928 | Not Available | 606 | Open in IMG/M |
3300010320|Ga0134109_10064817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1229 | Open in IMG/M |
3300010322|Ga0134084_10060266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1138 | Open in IMG/M |
3300010323|Ga0134086_10432958 | Not Available | 534 | Open in IMG/M |
3300010337|Ga0134062_10129246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1107 | Open in IMG/M |
3300010371|Ga0134125_10444011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1438 | Open in IMG/M |
3300011271|Ga0137393_10796930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 808 | Open in IMG/M |
3300012198|Ga0137364_11082165 | Not Available | 604 | Open in IMG/M |
3300012198|Ga0137364_11097524 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300012199|Ga0137383_10644566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 774 | Open in IMG/M |
3300012200|Ga0137382_10893406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
3300012202|Ga0137363_11483906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
3300012205|Ga0137362_11084663 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
3300012208|Ga0137376_10862668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 778 | Open in IMG/M |
3300012210|Ga0137378_10039866 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
3300012211|Ga0137377_10217742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1834 | Open in IMG/M |
3300012211|Ga0137377_11056909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 742 | Open in IMG/M |
3300012211|Ga0137377_11179469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
3300012349|Ga0137387_10334836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1095 | Open in IMG/M |
3300012349|Ga0137387_11308728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300012351|Ga0137386_11269215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300012356|Ga0137371_10484828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 955 | Open in IMG/M |
3300012385|Ga0134023_1110611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
3300012391|Ga0134035_1284683 | Not Available | 502 | Open in IMG/M |
3300012409|Ga0134045_1110788 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
3300012975|Ga0134110_10038140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1888 | Open in IMG/M |
3300012975|Ga0134110_10340807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
3300012975|Ga0134110_10389374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
3300014150|Ga0134081_10311705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
3300014150|Ga0134081_10426386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300014154|Ga0134075_10207892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
3300014166|Ga0134079_10193379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 849 | Open in IMG/M |
3300015053|Ga0137405_1186598 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
3300015054|Ga0137420_1499230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2211 | Open in IMG/M |
3300018431|Ga0066655_10646911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 715 | Open in IMG/M |
3300018431|Ga0066655_10944752 | Not Available | 592 | Open in IMG/M |
3300018431|Ga0066655_11152067 | Not Available | 546 | Open in IMG/M |
3300018433|Ga0066667_10337965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1191 | Open in IMG/M |
3300018433|Ga0066667_11180630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 665 | Open in IMG/M |
3300018482|Ga0066669_11575356 | Not Available | 599 | Open in IMG/M |
3300026277|Ga0209350_1119303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 600 | Open in IMG/M |
3300026295|Ga0209234_1046290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1655 | Open in IMG/M |
3300026297|Ga0209237_1261584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300026298|Ga0209236_1187660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 801 | Open in IMG/M |
3300026301|Ga0209238_1244883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300026310|Ga0209239_1084746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1364 | Open in IMG/M |
3300026313|Ga0209761_1102130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1431 | Open in IMG/M |
3300026323|Ga0209472_1295071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
3300026324|Ga0209470_1104185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1271 | Open in IMG/M |
3300026329|Ga0209375_1258236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
3300026331|Ga0209267_1024885 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
3300026331|Ga0209267_1078356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1433 | Open in IMG/M |
3300026331|Ga0209267_1292831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
3300026332|Ga0209803_1349539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300026335|Ga0209804_1257441 | Not Available | 639 | Open in IMG/M |
3300026524|Ga0209690_1018081 | All Organisms → cellular organisms → Bacteria | 3604 | Open in IMG/M |
3300026528|Ga0209378_1232210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
3300026547|Ga0209156_10306321 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 716 | Open in IMG/M |
3300027616|Ga0209106_1094690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
3300027643|Ga0209076_1100556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 821 | Open in IMG/M |
3300027655|Ga0209388_1158695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
3300031820|Ga0307473_10679540 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 720 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 33.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 21.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25384J37096_100215791 | 3300002561 | Grasslands Soil | AGDIAGLLANAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA* |
JGI25382J37095_101306054 | 3300002562 | Grasslands Soil | QTAALAGDIAGLLANAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA* |
JGI25390J43892_100333651 | 3300002911 | Grasslands Soil | MLAGDIAGLLANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
JGI25389J43894_11088212 | 3300002916 | Grasslands Soil | QTAALAGDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0066674_101686154 | 3300005166 | Soil | AGDIAGLLANAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA* |
Ga0066677_102588381 | 3300005171 | Soil | QLGRDIARLLAEAYEARRLAPPRWVQDLLRQYRSARSKSAGEVA* |
Ga0066688_101621364 | 3300005178 | Soil | LGRAITALLADAYQTRRLASPRWVQDLLRHYEPRRGKSSSEVA* |
Ga0066688_108613591 | 3300005178 | Soil | GRDIARLLAEAYEARRLSPPRWVQDLLRQYRAARSKSAGEVA* |
Ga0066684_100841881 | 3300005179 | Soil | IAALLVESYETRRLAPPRWVQDLLRHYRPRRGKAASEVA* |
Ga0066684_101701134 | 3300005179 | Soil | QTGQLGRDIARLLAEAYETRRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0066676_100512831 | 3300005186 | Soil | AIAELLVESYEVRRLSPPRWVQALLRHYRPLRGKAASEVA* |
Ga0066689_107955552 | 3300005447 | Soil | DIARLLAEAYETRRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0066681_108333332 | 3300005451 | Soil | QLGRDIAALLAEGYEARRLEPPRWVEELLRQFRRPRGKAASEVA* |
Ga0066697_104779353 | 3300005540 | Soil | AGLLAAAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0066701_100284615 | 3300005552 | Soil | ANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0066695_100926124 | 3300005553 | Soil | DIAGLVANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0066695_108297381 | 3300005553 | Soil | SPQQTEQLGRTITALLAEAYAARRLSSPRWVQDLLRHYEPRRGKTSSEVA* |
Ga0066707_102053881 | 3300005556 | Soil | TQQTAALAGDIAGLLANAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA* |
Ga0066698_104928671 | 3300005558 | Soil | PKQTLDLGRALADLLVESYEVRRLSPPRWVRDLVRHYESRPGKAASDVA* |
Ga0066670_106630973 | 3300005560 | Soil | ELGGSLAELLVESYEVRRLSPPRWVRDLVRHYESRPGKAASDVA* |
Ga0066699_102476874 | 3300005561 | Soil | ADLSPQQTEQLGRTITALLAEAYAARRLSSPRWVQDLLRHYEPRRGKTSSEVA* |
Ga0066693_102798982 | 3300005566 | Soil | LAGLLVDSYEARRLSPPRWVQDLVRHYQPRRGKAASEVA* |
Ga0066708_105436361 | 3300005576 | Soil | LGREIAILLAEAYEARRLSPPAWVRSLLRQYRTGRRKAAGQVA* |
Ga0066654_107416712 | 3300005587 | Soil | QTVQLGRAIAALLVESYETRRLVPPPWVRELLRHYRPRRGKAAGEVA* |
Ga0066656_109584621 | 3300006034 | Soil | AMLAGDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0066656_111054092 | 3300006034 | Soil | AIAALLVESYETRRLVPPPWVRELLRHYRPRRGKAAGEVA* |
Ga0066658_101083392 | 3300006794 | Soil | SPEHTLDLGRALAGLLVDSYEARRLSPPRWVQDLVRHYQPRRGKAASEVA* |
Ga0066659_101064051 | 3300006797 | Soil | QTEQLGRAVTALLAEAYAARRLSSPRWVQDLLRHYEPRRGKTSSEVA* |
Ga0099793_104765102 | 3300007258 | Vadose Zone Soil | LAAAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0099794_103160031 | 3300007265 | Vadose Zone Soil | LGGTLAELLLQSYEVRRLSPPRWVRDLLRHYRPRRGKSASEVA* |
Ga0066710_1027563381 | 3300009012 | Grasslands Soil | GQLGRDTARLLAEAYETRRLAPPRWVQDLVRQYRSARSKSAGEVA |
Ga0066710_1034621981 | 3300009012 | Grasslands Soil | PEHTLDLGRALAGLLVDSYEARRLSPPRWVQDLVRHYQPRRGKAASEVA |
Ga0066710_1048866262 | 3300009012 | Grasslands Soil | LVANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA |
Ga0099830_105040602 | 3300009088 | Vadose Zone Soil | LVQSYEVRRLSPPRWVQDLLRHYRPRRGKAASEVA* |
Ga0099828_102815301 | 3300009089 | Vadose Zone Soil | TAALAGDIAGLLASGYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0099828_105527731 | 3300009089 | Vadose Zone Soil | LAELLVQSYEVRRLSPPRWVRDLLRHYRTRRGKAASEVA* |
Ga0066709_1002878081 | 3300009137 | Grasslands Soil | HQTGQLGRDIARLLAEAYETRRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0066709_1003864461 | 3300009137 | Grasslands Soil | TLDLGRALAGLLVDSYEARRLSPPRWVQDLVRHYQPRRGKAASEVA* |
Ga0114129_124381771 | 3300009147 | Populus Rhizosphere | QQTAALAGDIAGLLASAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0134088_102734573 | 3300010304 | Grasslands Soil | SPKQALELGGGLAELLVESYEVRRLSPPRWVRDLVRHYESRPGKAASDVA* |
Ga0134088_104889282 | 3300010304 | Grasslands Soil | LAEAYAARRLSSPRWVQDLLRHYEPRRGKTSSEVA* |
Ga0134109_100648171 | 3300010320 | Grasslands Soil | RAIAALLVESYETRRLVPPPWVRELLRHYRPRRGKAAGEVA* |
Ga0134084_100602664 | 3300010322 | Grasslands Soil | VQLGRAIAALLVESYETRRLVPPPWVRELLRHYRPRRGKAAGEVA* |
Ga0134086_104329583 | 3300010323 | Grasslands Soil | GLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0134062_101292464 | 3300010337 | Grasslands Soil | LLAEAYETRRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0134125_104440112 | 3300010371 | Terrestrial Soil | DVAALLAAAYETRRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0137393_107969302 | 3300011271 | Vadose Zone Soil | ELGRALAELLVQSYEVRRLSPPRWVQDLLRFYRARRGKAASEVA* |
Ga0137364_110821651 | 3300012198 | Vadose Zone Soil | AGDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0137364_110975241 | 3300012198 | Vadose Zone Soil | TQQTAALAGDIAGLLASAYEARRLSPPRWVQDLLHHYRVRRGKAASEVA* |
Ga0137383_106445661 | 3300012199 | Vadose Zone Soil | AHLLVESYEARRLSPPRWVQDLLRYYRPRGGKAASEVA* |
Ga0137382_108934061 | 3300012200 | Vadose Zone Soil | LANAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA* |
Ga0137363_114839062 | 3300012202 | Vadose Zone Soil | QQTAMLAGDIAGLLANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0137362_110846631 | 3300012205 | Vadose Zone Soil | TLELGRALAELLVHSYEVRRLSPPRWVQDLLRHYRPRRGKAASEVA* |
Ga0137376_108626681 | 3300012208 | Vadose Zone Soil | ALLAEAYAARRLSSPRWVQDLLRHYQPRRGKTSSEVA* |
Ga0137378_100398666 | 3300012210 | Vadose Zone Soil | LAEAYEARRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0137377_102177424 | 3300012211 | Vadose Zone Soil | GQLGRDIARLLAEAYEARRLAPPRWVQDLVRQYRSARSKSAGEVA* |
Ga0137377_110569092 | 3300012211 | Vadose Zone Soil | AGLLAAAYETRRLSPPRWVQQFLQQYRARRGKTASEVA* |
Ga0137377_111794691 | 3300012211 | Vadose Zone Soil | LLVESYETRRLVPPPWVRELLRHYRPRRGKAAGEVA* |
Ga0137387_103348361 | 3300012349 | Vadose Zone Soil | AHTIELGRALAGLLVETYEARRLSPPRWVQDLVRYYQPRRGKAASEVA* |
Ga0137387_113087281 | 3300012349 | Vadose Zone Soil | IAGLLATAYDARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0137386_112692152 | 3300012351 | Vadose Zone Soil | GLLANEYEARRLSPPRWVQDLLRHYRVRRGKAASEVA* |
Ga0137371_104848281 | 3300012356 | Vadose Zone Soil | GREIAGLLAAAYETRRLSPPRWVQQFLQQYRARRGKTASEVA* |
Ga0134023_11106112 | 3300012385 | Grasslands Soil | LAGDIAGLLAVAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0134035_12846831 | 3300012391 | Grasslands Soil | TVLLADAYTARRLASPRWVQQLLRHYQTRRGKSSSEVA* |
Ga0134045_11107881 | 3300012409 | Grasslands Soil | LSPVQTLELGRVLAELLVQSYEVRRLSPPRWVQDLLRHYRPRRGKAASEVA* |
Ga0134110_100381405 | 3300012975 | Grasslands Soil | AAAYETRRLSPPRWVQQFLQQYRARRGKTASEVA* |
Ga0134110_103408072 | 3300012975 | Grasslands Soil | LAGDIAGLLANAYEARRLSPPRWVQELLRHYRVRRGKAASEVA* |
Ga0134110_103893741 | 3300012975 | Grasslands Soil | QTVQLGRDIAILLAEAYEARRLSPPAWVRSLLRQYRTGRRKAAGQVA* |
Ga0134081_103117052 | 3300014150 | Grasslands Soil | DIAELLAEAYETRRLEPPRWVQALLRHFRPRGKAASEVA* |
Ga0134081_104263861 | 3300014150 | Grasslands Soil | LGRALAELLVQSYEVRRLSPPRWVQDLLRHYRARRGKAASEVA* |
Ga0134075_102078921 | 3300014154 | Grasslands Soil | QTLELGRVLAELLVQSYEVRRLSPPRWVQDLLRHYRPRRGKAASEVA* |
Ga0134079_101933793 | 3300014166 | Grasslands Soil | GRAITALLADAYATRRLSSPRWVQELLRHYEPRRGKTSSEVA* |
Ga0137405_11865981 | 3300015053 | Vadose Zone Soil | AGDIAALLATLATGYETRRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0137420_14992301 | 3300015054 | Vadose Zone Soil | IAGLLATAYETRRLSPPRWVQDLLRHYRVRRGKTASEVA* |
Ga0066655_106469111 | 3300018431 | Grasslands Soil | IAGLLAAAYEARRLSPPRWVQELLRHYRVRRGKAASEVA |
Ga0066655_109447522 | 3300018431 | Grasslands Soil | SSYVSHQQTEQLGREIAARLVRSYEARGLSPPRWVQDLLRHYRPRRRKAAAAGEVA |
Ga0066655_111520671 | 3300018431 | Grasslands Soil | TAMLAGDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA |
Ga0066667_103379654 | 3300018433 | Grasslands Soil | GDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKTASEVA |
Ga0066667_111806301 | 3300018433 | Grasslands Soil | ALLAEAYAARRLSSPRWVQDLLRHYEPRRVKTSSEVA |
Ga0066669_115753563 | 3300018482 | Grasslands Soil | LSTQQTAALAGDIAALLANAYEARRLSPPRWVQDLLRHYRVRRGKSASEVA |
Ga0209350_11193032 | 3300026277 | Grasslands Soil | QLGRDIARLLAEAYETRRLAPPRWVQDLVRQYRSARTKSAGEVA |
Ga0209234_10462901 | 3300026295 | Grasslands Soil | QQTAALAGDIAALLANAYEARRLSPPRWVQDLLRHYRVRRGKSASEVA |
Ga0209237_12615842 | 3300026297 | Grasslands Soil | LGLGRALAGLLVESYEARRLSPPRWVQDLVRHYRPRGKAASEVA |
Ga0209236_11876601 | 3300026298 | Grasslands Soil | GDIAGLLATAYDARRLSPPRWVQDLLRHYRVRRGKTASEVA |
Ga0209238_12448832 | 3300026301 | Grasslands Soil | QTAALAGDIAGLLATAYEARRLSPPRWVQDLLRHYRVRRGKAASEVA |
Ga0209239_10847464 | 3300026310 | Grasslands Soil | TAMLAGDIAGLLATAYDARRLSPPRWVQDLLRHYRVRRGKTASEVA |
Ga0209761_11021304 | 3300026313 | Grasslands Soil | RAVTALLAEAYAARRLSSPRWVQDLLRHYEPRRGKTSSEVA |
Ga0209472_12950711 | 3300026323 | Soil | GRDIAALLAEGYEARRLEPPRWVEELLRQFRRPRGKAASEVA |
Ga0209470_11041851 | 3300026324 | Soil | FGRAIAELLVESYEVRRLSPPRWVQALLRHYRPLRGKAASEVA |
Ga0209375_12582363 | 3300026329 | Soil | LSKAYESRSLSPPRWAQELLRHYRARPGKSETEVA |
Ga0209267_10248853 | 3300026331 | Soil | LLVESYEARRLSPPRWVQDLLRYYRPRGGKAASEVA |
Ga0209267_10783564 | 3300026331 | Soil | QQTEQLGRAITALLADAYQTRRLASPRWVQDLLRHYEPRRGKSSSEVA |
Ga0209267_12928312 | 3300026331 | Soil | RDIARLLAEAYEARRLSPPRWVQDLLRQYRAARSKSAGEVA |
Ga0209803_13495391 | 3300026332 | Soil | ELGRTVAHLLVESYEARRLSPPRWVQDLLRYYRPHGGKAASEVA |
Ga0209804_12574411 | 3300026335 | Soil | EQLGRAITALLADAYTARRLSSPRWVQDLLRHYDTRRGKTSSEVA |
Ga0209690_10180815 | 3300026524 | Soil | LATAYEARRLSPPRWVQELLRHYRVRRGKTASEVA |
Ga0209378_12322102 | 3300026528 | Soil | HTLDLGRALAGLLVDSYEARRLSPPRWVQDLVRHYQPRRGKAASEVA |
Ga0209156_103063212 | 3300026547 | Soil | LLAAAYETRRLSPPRWVQQFLQQYRARRGKTASEVA |
Ga0209106_10946901 | 3300027616 | Forest Soil | GDIAGLLAAAYEARRLSPPRWVQELLRHYRVRRGKAASEVA |
Ga0209076_11005562 | 3300027643 | Vadose Zone Soil | ALLATAYETRRLSPPRWVQDLLRHYRVRRGKTASEVA |
Ga0209388_11586952 | 3300027655 | Vadose Zone Soil | RALAELLVQSYEARRLSPPRWVRDLLRHYRTRRGKVASEVA |
Ga0307473_106795403 | 3300031820 | Hardwood Forest Soil | AALAGDIAGLLATAYEARRLSPPRWVQELLRHYRVRRVKAASEVA |
⦗Top⦘ |