NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100945

Metagenome Family F100945

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100945
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 122 residues
Representative Sequence MIEEQAPQTDFYLKLDSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPLDGWHINVRLVGDARRADVEALDAAYGVTPKSPSRVWL
Number of Associated Samples 66
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.29 %
% of genes near scaffold ends (potentially truncated) 49.02 %
% of genes from short scaffolds (< 2000 bps) 72.55 %
Associated GOLD sequencing projects 46
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (49.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(42.157 % of family members)
Environment Ontology (ENVO) Unclassified
(92.157 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.510 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.46%    β-sheet: 37.82%    Coil/Unstructured: 48.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF03382DUF285 7.84
PF13385Laminin_G_3 5.88
PF08291Peptidase_M15_3 3.92
PF00959Phage_lysozyme 2.94
PF01510Amidase_2 2.94
PF06074DUF935 0.98
PF14550Peptidase_S78_2 0.98
PF17212Tube 0.98
PF13392HNH_3 0.98
PF02954HTH_8 0.98
PF00166Cpn10 0.98
PF00574CLP_protease 0.98
PF02767DNA_pol3_beta_2 0.98
PF11160Hva1_TUDOR 0.98
PF06067DUF932 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.96
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.96
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.98
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 0.98
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.98
COG4383Mu-like prophage protein gp29Mobilome: prophages, transposons [X] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.43 %
UnclassifiedrootN/A21.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003617|JGI26082J51739_10007769All Organisms → cellular organisms → Bacteria → Proteobacteria5561Open in IMG/M
3300003617|JGI26082J51739_10008694All Organisms → cellular organisms → Bacteria5161Open in IMG/M
3300006029|Ga0075466_1017035All Organisms → Viruses → Predicted Viral2396Open in IMG/M
3300006029|Ga0075466_1086638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria866Open in IMG/M
3300006752|Ga0098048_1020415All Organisms → Viruses → Predicted Viral2224Open in IMG/M
3300006752|Ga0098048_1226636All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium549Open in IMG/M
3300006789|Ga0098054_1033302All Organisms → Viruses → Predicted Viral2011Open in IMG/M
3300006793|Ga0098055_1083441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300006793|Ga0098055_1349650All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300006793|Ga0098055_1391324Not Available515Open in IMG/M
3300006802|Ga0070749_10005276Not Available8542Open in IMG/M
3300006802|Ga0070749_10074651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2030Open in IMG/M
3300006802|Ga0070749_10089203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Mameliella → Mameliella alba1832Open in IMG/M
3300006802|Ga0070749_10271770All Organisms → cellular organisms → Bacteria → Proteobacteria956Open in IMG/M
3300006802|Ga0070749_10317698All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300006802|Ga0070749_10416119Not Available740Open in IMG/M
3300006802|Ga0070749_10501629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300006802|Ga0070749_10715656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300006802|Ga0070749_10792474Not Available503Open in IMG/M
3300006803|Ga0075467_10280560Not Available893Open in IMG/M
3300006810|Ga0070754_10019587All Organisms → Viruses → Predicted Viral3983Open in IMG/M
3300006916|Ga0070750_10369268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300006916|Ga0070750_10375028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius indicus597Open in IMG/M
3300006916|Ga0070750_10392842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300006924|Ga0098051_1208502Not Available509Open in IMG/M
3300006925|Ga0098050_1093273All Organisms → cellular organisms → Bacteria → Proteobacteria772Open in IMG/M
3300006990|Ga0098046_1123560Not Available565Open in IMG/M
3300006990|Ga0098046_1148758Not Available500Open in IMG/M
3300007236|Ga0075463_10250219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Antarcticimicrobium → Antarcticimicrobium sediminis569Open in IMG/M
3300007344|Ga0070745_1079767All Organisms → Viruses → Predicted Viral1302Open in IMG/M
3300007344|Ga0070745_1124809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria990Open in IMG/M
3300007345|Ga0070752_1079834All Organisms → Viruses → Predicted Viral1432Open in IMG/M
3300007346|Ga0070753_1128433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium971Open in IMG/M
3300007538|Ga0099851_1204635All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon717Open in IMG/M
3300007541|Ga0099848_1011537Not Available3889Open in IMG/M
3300007640|Ga0070751_1085999All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300009124|Ga0118687_10059131Not Available1286Open in IMG/M
3300009124|Ga0118687_10346116Not Available567Open in IMG/M
3300009467|Ga0115565_10112845All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300009474|Ga0127390_1118842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300009505|Ga0115564_10491772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300010149|Ga0098049_1061327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → Thalassobius litoralis1193Open in IMG/M
3300010150|Ga0098056_1225461All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium623Open in IMG/M
3300010150|Ga0098056_1313374All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium516Open in IMG/M
3300010297|Ga0129345_1056036All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300010389|Ga0136549_10008945All Organisms → cellular organisms → Bacteria6848Open in IMG/M
3300011253|Ga0151671_1002713Not Available14398Open in IMG/M
3300013010|Ga0129327_10244128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius indicus916Open in IMG/M
3300017718|Ga0181375_1086216Not Available508Open in IMG/M
3300017989|Ga0180432_10441018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales958Open in IMG/M
3300021425|Ga0213866_10137068All Organisms → Viruses → Predicted Viral1307Open in IMG/M
3300022072|Ga0196889_1007692All Organisms → Viruses → Predicted Viral2432Open in IMG/M
3300022183|Ga0196891_1076540All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300022198|Ga0196905_1003198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6052Open in IMG/M
(restricted) 3300023109|Ga0233432_10391564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
(restricted) 3300024052|Ga0255050_10198355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
(restricted) 3300024059|Ga0255040_10008617All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3325Open in IMG/M
(restricted) 3300024062|Ga0255039_10015238All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2682Open in IMG/M
(restricted) 3300024062|Ga0255039_10034215All Organisms → Viruses → Predicted Viral1868Open in IMG/M
(restricted) 3300024062|Ga0255039_10036623All Organisms → Viruses → Predicted Viral1813Open in IMG/M
(restricted) 3300024062|Ga0255039_10043855All Organisms → cellular organisms → Bacteria → Proteobacteria1676Open in IMG/M
(restricted) 3300024062|Ga0255039_10233236All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
(restricted) 3300024517|Ga0255049_10144687All Organisms → Viruses → Predicted Viral1082Open in IMG/M
(restricted) 3300024517|Ga0255049_10590311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp.518Open in IMG/M
(restricted) 3300024518|Ga0255048_10090541All Organisms → Viruses → Predicted Viral1516Open in IMG/M
(restricted) 3300024518|Ga0255048_10206673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae958Open in IMG/M
(restricted) 3300024520|Ga0255047_10084098All Organisms → Viruses → Predicted Viral1638Open in IMG/M
(restricted) 3300024520|Ga0255047_10211205All Organisms → Viruses987Open in IMG/M
(restricted) 3300024520|Ga0255047_10437393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
(restricted) 3300024520|Ga0255047_10522315Not Available596Open in IMG/M
(restricted) 3300024520|Ga0255047_10572031Not Available566Open in IMG/M
(restricted) 3300024520|Ga0255047_10581066Not Available561Open in IMG/M
3300025070|Ga0208667_1002307All Organisms → cellular organisms → Bacteria6301Open in IMG/M
3300025070|Ga0208667_1055610Not Available630Open in IMG/M
3300025083|Ga0208791_1005700All Organisms → cellular organisms → Bacteria3364Open in IMG/M
3300025083|Ga0208791_1087120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → Thalassobius litoralis500Open in IMG/M
3300025084|Ga0208298_1020078All Organisms → Viruses → Predicted Viral1491Open in IMG/M
3300025085|Ga0208792_1010314All Organisms → Viruses → Predicted Viral2134Open in IMG/M
3300025098|Ga0208434_1013115All Organisms → Viruses → Predicted Viral2223Open in IMG/M
3300025103|Ga0208013_1038594Not Available1334Open in IMG/M
3300025108|Ga0208793_1126868All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium693Open in IMG/M
3300025508|Ga0208148_1102225Not Available615Open in IMG/M
3300025646|Ga0208161_1027781All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300025647|Ga0208160_1011839All Organisms → cellular organisms → Bacteria → Proteobacteria2933Open in IMG/M
3300025655|Ga0208795_1127811Not Available655Open in IMG/M
3300025671|Ga0208898_1038817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1847Open in IMG/M
3300025684|Ga0209652_1008774All Organisms → cellular organisms → Bacteria → Proteobacteria6286Open in IMG/M
3300025759|Ga0208899_1031557All Organisms → Viruses → Predicted Viral2472Open in IMG/M
3300025769|Ga0208767_1016679All Organisms → cellular organisms → Bacteria → Proteobacteria4244Open in IMG/M
3300025809|Ga0209199_1047000All Organisms → Viruses → Predicted Viral2175Open in IMG/M
3300025809|Ga0209199_1095053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → Thalassobius litoralis1248Open in IMG/M
3300025810|Ga0208543_1024147All Organisms → cellular organisms → Bacteria → Proteobacteria1538Open in IMG/M
3300025853|Ga0208645_1124536All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300025887|Ga0208544_10077995All Organisms → Viruses → Predicted Viral1534Open in IMG/M
3300025889|Ga0208644_1059635Not Available2061Open in IMG/M
3300025889|Ga0208644_1069801All Organisms → Viruses → Predicted Viral1845Open in IMG/M
3300025889|Ga0208644_1100779All Organisms → Viruses → Predicted Viral1423Open in IMG/M
3300025889|Ga0208644_1201932All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300027917|Ga0209536_102759134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp.573Open in IMG/M
3300034375|Ga0348336_029310All Organisms → Viruses → Predicted Viral2629Open in IMG/M
3300034418|Ga0348337_166287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium599Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous42.16%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.55%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater11.76%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.88%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.92%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.96%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.96%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.98%
MarineEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.98%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.98%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.98%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.98%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084004Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_4EnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009474Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22226079422222084004MarineMDETIIEAPKVDFFLKLASEADMPTAFADFYKQDYVTVVDEETGEETQTPDGDKYLVTHTHDYAIDVVGVIHEPTGNMLTDAEGTEYPETAPVDGWHVNVRLVGDAVRESVEAIDAVYGVVPNSPSRVFL
JGI26082J51739_1000776943300003617MarineMSEIIEQVVEEVVEPKKTDYFIKLNSEADLPTVFSAFYKQDYVTVVDEETGEETQTPEGEPYLVTHTHDYAIDVVGVIHEPTGNMLTDDEGNEYAETAPVDGWHVNVRLVGDAMRETVEALDALYGVVPNSPSRVFL*
JGI26082J51739_1000869443300003617MarineMSEIIEQVVEEVVEPKKTDYFIKLNSEADLPTVFSAFYKQDYVTVVDEETGEETQTPEGEPYLVTHTHDYAIDVVGVIHEPTGNMLTDDEGNEYAETAPVDGWHVNVRLVGDXXRETVEAXDALYGVVPNSPSRVFL*
Ga0075466_101703533300006029AqueousMFEETTQTRNDFFLKLASEADMPTVLSAFYRQDTETTVDDETGEETVINVGEPYMVMQTADYAIDIVGVIYRATGNTLTDADGNEYPEQVPLDGWHVNIRLIGDAMRDTVEALDAIYGVQPNAPARIFL*
Ga0075466_108663813300006029AqueousMPSVLAAFYKQDYTTIVDPETGEESTQVEGDPYLVAHTPDYAIDVVGTIQEPTGVVLTDAEGNESPEMATLDGWHINLRLVGEAKRADAEALSDYVVNPEPMTPSRVWL*
Ga0098048_102041573300006752MarineEADTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDVVGVIREPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRSDAEALDAAYGVTPKSPSRVWL*
Ga0098048_122663623300006752MarineFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0098054_103330233300006789MarineMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEETGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYPETTPLDGWHINVRLVGDARRADVEALDAAYGVTPNSPTRVWL*
Ga0098055_108344113300006793MarineMIEETPPKTDFYVRLQSEADTPAALSAFYHQDYTVTVDEETGEEIQTPEGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRADVEA
Ga0098055_134965013300006793MarineYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDVVGVIHKPTGNTLTDDAGFEYEETTPLDGWHLNVRLMGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0098055_139132413300006793MarineMIEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYEETTPLDGWHINVRLVGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0070749_1000527623300006802AqueousMTDEIQTPKTDFYLKLSSEADMPTALSAFYRQDTKTEVDDETGEETVINVGDPYLVSHTADYAIDVVGIIYKLTGVILEDDTPEVASLDGWHINIRLNGDNRRADVEALSAYFVDPEPTTPSRVWL*
Ga0070749_1007465113300006802AqueousVTEEVIEAPQRDFYIKLNAEADTASIFAAFYTQDYVTVVDEEGNETQTPDGDPYLVTHTHDYAIDIVGVIQKPTGNVITDAEGNEIPEMAPVAGHHVNVRLTNDNRRDDVEA
Ga0070749_1008920333300006802AqueousMTDKIIEAPKTDFYLKLASEDDMPTALVAFYKQDYTTIVDPNTGEEVTQLEGSPYLVQNTSDYAIDVVGTIWKPTGVMLADDIPEMKALDGWHINIRLNGDARRADVEALSAYFVDPEPITPSRVWL*
Ga0070749_1027177013300006802AqueousVTEEVIEAPQRDFYIKLNAEADMPSVFAAFYTQDYVTVVDEEGVETQTPDGDPYLVAHTHDYAIDIVGVIQKPTGNVITDAEGNEIPEMAPVAGHHVNVRLTNDNRRDDVEAINAIYGQAPVTPARVFL*
Ga0070749_1031769823300006802AqueousEADLPTAFAAFYKQDYVTVVDEETGESTQTPDGDAYLVTHSHDYAIDLVGVIYEPTGNMLTDDEGNEYPETAPVDGWHVNVRLVGDGRRVDIEDIDAVYGVTPNSPSRVFL*
Ga0070749_1041611923300006802AqueousMDGLTEAPKTDFYLKLASEADMPTALAAFYRQDTETTVDGETGEETVINVGDPYLVSHTADYAIDVVGIIYKPTGNILTDADGFEYEETAPLDGWHINLRLNGDARRADAEALSAYFVDPEPATPSRVWL*
Ga0070749_1050162923300006802AqueousTEEITKTDFYLKLASEADMPTALSAFYRQDTKTEVDDETGEETVINVGEPYLVSHTADYAIDVVGVIYKPTGVILEDDIPEVAPLNGWHINLRLNGDARRADAEALSAYFVDPEPATPSRVWL*
Ga0070749_1071565613300006802AqueousSITGANIVIEDIIEAPKTDFYIKLNSEADLPTVFSAFYKQDYVTVVDEEGNETQTPEGEPYFVSHTHDYAIDLVGVIYEPTGNMLTDDEGNEYPETAPVDGYHVNVRLIGDGRREDVEAIDATHGVVPNSPSRIFL*
Ga0070749_1079247413300006802AqueousMDGLTEAPKTDFYLKLASEVDMPTALAAFYRQDTETTVDGETGEETVTNVGDPYLVSHTADYAIDVVGVSYKPTGNTLTDADGFEYEETAPLDGWHINLRLNGDARRA
Ga0075467_1028056013300006803AqueousRHQPMFKETTQTRNDFFLKLASEADMPTVLSAFYRQDTETTVDDETGEETVINVGEPYMVMQTADYAIDIVGVIYRATGNTLTDADGNEYPEQVPLDGWHVNIRLIGDAMRDTVEALDAIYGVQPNAPARIFL*
Ga0070754_1001958743300006810AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGDARREDVEALDALYGVTPTSPRRVWL*
Ga0070750_1036926823300006916AqueousMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTIVDPETGEESTQLEGEPYLVMHTADYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINIRLMGDG
Ga0070750_1037502823300006916AqueousMIEEIEPIRSDFYIRLNAEADMPTALSAFYRQDYTTVVDPETGEESTQIEGDPYLVQFTPDYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINIRLMGDG
Ga0070750_1039284213300006916AqueousPVIDTPKTDFYLKLASEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNILMDAEGFEYPETAPLDGWHINIRLVGDARREDVEALDALYGVTPTSPRRVWL*
Ga0098051_120850213300006924MarineMLEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTP
Ga0098050_109327333300006925MarineMLEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0098046_112356013300006990MarineMIEETPPKTDFYLRLQSEADTPAALSAFYHQDTVTETDPETGEETVTTVGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRADVEALDAAYGVTPKSPSRVWL*
Ga0098046_114875813300006990MarineEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0075463_1025021913300007236AqueousMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTIVDPETGGERTQLEGEPYLVMHTADYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHIN
Ga0070745_107976733300007344AqueousMIDEPVIDTPKTDFYLKLASEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGEARREDVEALDALYGVTPTSPRRVWL*
Ga0070745_112480923300007344AqueousVTDIIEEVVEEVVEPKKTDFYIKLNSEADLPTVFSAFYKQDYVTVVDEETGESTQTPEGEAYLVTHTHDYAIDLVGTIYEPTGNMLTDDEGNEYPETAPIDGWHVNVRLVGDGRREDVEAIDATYGVVPNSPSR
Ga0070752_107983423300007345AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEEAVTPDGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGEARREDVEALDALYGVTPNSPRRVWL*
Ga0070753_112843323300007346AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDPEGFEYPETAPLDGWHINIRLVGDARRDDVEALDALYGVTPTSPRRVWL*
Ga0099851_120463523300007538AqueousMETIIEETLEAPKRDYFIKLNSEADLPTAFAAFYKQDYVTVVDEETGESTQTPEGESYLVSHTHDYAIDLVGTIYAPTGNTLTDAEGNEYPEQAPVDGWHVNVRLVGDGRREDVEAIDAVYGVVPNSPSRV
Ga0099848_101153723300007541AqueousMTDDIIIDAPRTDFFIKLASEADMPTALAAFYRQDSTTVVDPDTGEEHVQLEGEPYLVQNTHDYAMDIVGVIHKPTGVMLTDAEGNEWPEMAPLDGWHINIRLIGDAVREAVEAVDAAYGVTPETPARVWA*
Ga0070751_108599933300007640AqueousYSGGERMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDADGFEYPETAPLDGWHINIRLVGDARREDVEALDALYGVTPTSPRRVWL*
Ga0118687_1005913163300009124SedimentIKLAAESDMAPVFAAFYTQDYVTVVDEEGNETQTPDGDPYLVTHTHDYAIDIVGVIQKPTGNVITDAEGNEIPEMAPVEGHHVNVRLVNDNRRDDVEAINAIYGQAPVTPARVFL*
Ga0118687_1034611623300009124SedimentFYIKLAAESDMAPVFAAFYTQDYVTVVDEEGNETQTPDGDPYLVTHTHDYAIDIVGVIYEPNGNVITDEEGNEIPEMAPIPGHHVNVRLTSEARRDDVEAINAVYGQAPVTPVRVFL*
Ga0115565_1011284513300009467Pelagic MarineMIEESTPPRNDFFLKLVSEADMPTALAAFYHQDTETTVDEETGEETVFNVGEPHLVPHTKDYAIDVVGVIYRPTGDMLTDADGNEYPEQAPLDGWHVNIRLIGDARRAD
Ga0127390_111884223300009474Meromictic PondMIKDNSVIMDELVIDTPKQDFYLRLPSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYTIDVVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGDARREDVEALDALYGVTPTSPRRVWL*
Ga0115564_1049177213300009505Pelagic MarineMIEESTPPRNDFFLKLVSEADMPTALAAFYHQDTETTVDEETGEETVFNVGEPHLVPHTKDYAIDVVGVIYRPTGDMLTDADGNEYPEQAPLDGWHVNIRLIGDARRADVEAIDAV
Ga0098049_106132723300010149MarineMIEETPPKTDFYVRLQSEADTPAALSAFYHQDYTVTVDEETGEEIQTPEGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRADVEALDAAYGVTP
Ga0098056_122546123300010150MarineMLEETPPKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINVRLMGDARRADVEALDAAYGVTPKSPSRVWL*
Ga0098056_131337423300010150MarineKMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDSAGFEYPETTPLDGWHINFRLVGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0129345_105603613300010297Freshwater To Marine Saline GradientMDELIIEAPKTDFFIRLPSEADLPTAFAAFYQQDYVTVVDEEGNETQTPEGDPYLVTHTHDYPIDLVGIIYEPTGNMLTDDEGNEYPETAPVDGWHVNVRLVGDARREDVEA
Ga0136549_10008945143300010389Marine Methane Seep SedimentMIEEPTIDAPKTDFYLRLPSEADMPMALAAFYRQDTVTEMDPETGEETVTNVGDPYLATHGPGYDIGIVGVIHEPIGNTLTDAEGNQYPETAPIDGWHINIRLSGDARRADVEALDALYGVTPNSPSRVWL*
Ga0151671_100271313300011253MarineMIDPIFTDFYLKLASEADTPTALSSFYKQDYTVTVDEETGEETQTPEGDPYLVMHTADYALDIVGVIHEPTGITLTDDAGFEYEETAPLDGWHINVRLIGDARRADVEALDAAYGVTPNSPSRVWL*
Ga0129327_1024412823300013010Freshwater To Marine Saline GradientMLEETTPIRTDFFLKLASEADMPTVLSAFYRQDTETTVDDETGEETVVNVGEPYLVAHTPDYAIDIVGVIHRPTGVILTDADGNEHPEQAPLDGWHVNIRIVGDAMRDTVEALDAICGVIPNRPARVWL*
Ga0181375_108621613300017718MarineMIEETPPKTDFYLRLQSEADTPTALSAFYKQDYTVLVDEDTGEETQTPEGDPYLVMHTPDYAIDIVSVIYKPTGNMLTDDSGFEYPEMALLDGWHINFRLVGDARRSDVEALDAAYGVTPSSPSRVWL
Ga0180432_1044101823300017989Hypersaline Lake SedimentMSEEQVTQTDFYLKLPSEADMPTVLSAFYRQDTKTEVDDETGEETVINVGEPYFVPNTKDYAIDVVGVIHKPTGKVITHPKGFTYNEMAPLEGWHVNIRLLSDAMRAEVETVAATYGVTPDTPSRVFA
Ga0213866_1013706833300021425SeawaterMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTIVDPETGEESTQLEGEPYLVMHTADYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINIRLMGDGRRDDVEALSAYFVDPEPATPSRVWL
Ga0196889_100769233300022072AqueousMFEETTQTRNDFFLKLASEADMPTVLSAFYRQDTETTVDDETGEETVINVGEPYMVMQTADYAIDIVGVIYRATGNTLTDADGNEYPEQVPLDGWHVNIRLIGDAMRDTVEALDAIYGVQPNAPARIFL
Ga0196891_107654023300022183AqueousMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTVVDPETGEESTQIEGDPYLVQFTPDYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINMRLMGDGRRDDVEAL
Ga0196905_100319813300022198AqueousMTDDIIIDAPRTDFFIKLASEADMPTALAAFYRQDSTTVVDPDTGEEHVQLEGEPYLVQNTHDYAMDIVGVIHKPTGVMLTDAEGNEWPEMAPLDGWHINIRLIGDAVREAVEAVDAAYGVTPETPARVWA
(restricted) Ga0233432_1039156413300023109SeawaterDFYLKLDSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHSPDYAIDIVGVIHKPTGNTLTDAEGNQYPETAPLDGWHINFRLVGDARRADVEALDATYGVTPNSPSRVWL
(restricted) Ga0255050_1019835523300024052SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTADYAIDIVGVIHKPTGNTLTNDAGFEYEETTPMDGWHINVRLVGDARRAD
(restricted) Ga0255040_1000861783300024059SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPMDGWHINVRLVGDARRADVEALDSLYGVTPNSPSRVWL
(restricted) Ga0255039_1001523883300024062SeawaterMELSEQNPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPMDGWHINVRLVGDARRADVEALDSLYGVTPNSPSRVWL
(restricted) Ga0255039_1003421513300024062SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHSPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPLDGWHINFRLVGDARRADVEALDATYGVTPNSPSRVWL
(restricted) Ga0255039_1003662333300024062SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTADYAIDIVGVIHKPTGNTLTNDAGFEYEETTPMDGWHINVRLVGDARRADVEALDAAYGVTPKSPSRVWL
(restricted) Ga0255039_1004385533300024062SeawaterMTDDIITAPKTDFYIRINAEADTPTALAAFYRQDTETTVDDETGEETVNNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPIDGWHINVRLVGDARRSDVEALDAAYGVIPNSPSRVWL
(restricted) Ga0255039_1023323613300024062SeawaterKTDFYIKLASEADMPTALSAFYRQDYTTIVDPETGEESTQIEGDPYLVMHSLDYAIDIVGVIHEPTGNTLTDAEGNQYPETAPIDGWHINIRLSGDARRADVEALDALYGVTPNSPSRVW
(restricted) Ga0255049_1014468733300024517SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTADYALDIVGVIHEPTGNTLTDDAGFEYEETAPLDGWHINVRLVGDARRADVEALDAAYGVTPKSPSRVWL
(restricted) Ga0255049_1059031123300024517SeawaterMIDEQAPKTDFYIKLASEADMPTALSAFYLQDYTTIVDPETGEESTQIEGDPYLVMHSLDYAIDIVGVIHEPTGNTLTDAEGNQYPETAPIDGWHINIRLSGDARRA
(restricted) Ga0255048_1009054133300024518SeawaterMELSEQTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTADYAIDIVGVIHKPTGNTLTNDAGFEYEETTPMDGWHINVRLVGDARRADVEALDSLYGVTPNSPSRVWL
(restricted) Ga0255048_1020667313300024518SeawaterKLDSEADTPTALAAIYRQDTVTEMDPETGEETVTNVGDPYLVMHSLDYAIDVVGTISEPTGNTLTDAEGNDYPETAPVPGWHINIRLVGDARRADVEAIDATYGVTPNSPSRVWL
(restricted) Ga0255047_1008409833300024520SeawaterMIEEQAPKTDFYLKLDSEADTPTALAAFYRQDTETTVDDETGEETVNNVGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPMDGWHINFRLVGDARRSDAEALGAAYGVTPKSPSRVWL
(restricted) Ga0255047_1021120533300024520SeawaterTPPRTDFYLRLNSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPMDGWHINVRLVGDARRADVEALDSLYGVTPNSPSRVWL
(restricted) Ga0255047_1043739323300024520SeawaterALAAFYRQDTETTVDDETGEETVNNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPIDGWHINVRLVGDARRSDVEALDAAYGVIPNSPSRVWL
(restricted) Ga0255047_1052231523300024520SeawaterLRLTNSNSQSSMRLKMELSEQTPPRTDFYLKLDSEADTPTVLAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPLDGWHINVRLVGDARRADVEALDSLYGVTPNSPSRVWL
(restricted) Ga0255047_1057203123300024520SeawaterMIEEQAPQTDFYLKLDSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPLDGWHINVRLVGDARRADVEALDAAYGVTPKSPSRVWL
(restricted) Ga0255047_1058106613300024520SeawaterMIEEQAPQTDFYLKLDSEADTPTALAAFYRQDTETTVDDETGEETVTNVGDPYLVMHAPDYAIDIVGVIHKPTGNTLTDDAGFEYEETAPIDGWHINVRLMGDARRSDAEALGAAYGVTPKSPSRVWL
Ga0208667_100230783300025070MarineMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINVRLMGDARRADVEALDAAYGVTPKSPSRVWL
Ga0208667_105561023300025070MarineMLEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTPNSPSRVWL
Ga0208791_100570083300025083MarineMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEETGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINVRLMGDARRADVEALDAAYGVTPKSPSRVWL
Ga0208791_108712023300025083MarineMIEETPPKTDFYVRLQSEADTPAALSAFYHQDYTVTVDEETGEEIQTPEGDPYLVMHTPDYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGD
Ga0208298_102007823300025084MarineMIEETPSKTDFYLRLQSEADTPAALSAFYHQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDIVGVIREPTGNTLTDDAGFEYPETTPLDGWHINFRIVGDARRADVEALDAAYGVTPNSPSRVWL
Ga0208792_101031433300025085MarineMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEETGEEIQTPEGDPYLVTHTANYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINVRLMGDARRADVEALDAAYGVTPKSPSRVWL
Ga0208434_101311513300025098MarineDTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTPDYAIDVVGVIREPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRSDAEALDAAYGVTPKSPSRVWL
Ga0208013_103859433300025103MarineMLEETPSKTDFYLRLQSEADTPAALSAFYKQDYTVTVDEDTGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRADVEALDAAYGVTPKSPSRVWL
Ga0208793_112686833300025108MarineAFYKQDYTVTVDEETGEEIQTPEGDPYLVMHTADYAIDIVGVIHKPTGNTLTDDAGFEYEETTPLDGWHINFRLVGDARRADVEALDAAYGVTPKSPSRVWL
Ga0208148_110222523300025508AqueousFYIKLASEADMPSVLAAFYKQDYTTIVDPETGEESTQVEGDPYLVAHTPDYAIDVVGTIQEPTGVVLTDAEGNESPEMATLDGWHINLRLVGEAKRADAEALSDYVVNPEPMTPSRVWL
Ga0208161_102778143300025646AqueousTLEAPKRDYFIKLNSEADLPTAFAAFYKQDYVTVVDEETGESAQTPEGEAYLVSHTHDYAIDLVGVIYAPTGNTLTDDEGNEYPEQAPIDGWHVNVRLVGDGRREDVEAIDATYGVVPNSPSRVFL
Ga0208160_101183933300025647AqueousMTDDIIIDAPRTDFFIKLASEADMPTALAAFYRQDSTTVVDPDTGEEHVQLEGEPYLVQNTHDYAMDIVGVIHKPTGVMLTDAEGNEWPEMAPLDGWHINIRLIGDAVREAVEAVDAA
Ga0208795_112781123300025655AqueousSMTDDIIIDAPRTDFFIKLASEADMPTALAAFYRQDSTTVVDEETGEEHVQLEGEPYLVQNTADYAMDIVGVIHKPTGVMLTDAEGNEWPEMAPLDGWHINIRLIGDAVREAVEAVDAAYGVTPETPARVWA
Ga0208898_103881713300025671AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDDEGFEYPETAPLDGWHINIRLVGDARRDDVEALD
Ga0209652_100877433300025684MarineMSEIIEQVVEEVVEPKKTDYFIKLNSEADLPTVFSAFYKQDYVTVVDEETGEETQTPEGEPYLVTHTHDYAIDVVGVIHEPTGNMLTDDEGNEYAETAPVDGWHVNVRLVGDAMRETVEALDALYGVVPNSPSRVFL
Ga0208899_103155723300025759AqueousMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTVVDPETGEESTQIEGDPYLVQFTPDYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINMRL
Ga0208767_101667923300025769AqueousMTEELIDAPKTDFYLRFSSEADMPTVLSAFYRQDYTTVVDPETGEESTQIEGDPYLVQFTPDYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINIRLMGDGRRDDVEALSAYFVDPEPATPSRVWL
Ga0209199_104700023300025809Pelagic MarineMIEEPTAPRNDFFLKLASEADMPTALAAFYHQDTETTVDSETGEETVINVGDPYLVQHTKDYAIDVVGVIYRPTGNMLTDADGNAYPEQAPLSGWHVNVRLVGEARRVDVEAADAVYGVIPNSPARVFL
Ga0209199_109505313300025809Pelagic MarineMIEESTPPRNDFFLKLVSEADMPTALAAFYHQDTETTVDEETGEETVFNVGEPHLVPHTKDYAIDVVGVIYRPTGDMLTDADGNEYPEQAPLDGWHVNIRLIGDARRADVEAIDAVY
Ga0208543_102414723300025810AqueousMTEELIDAPKTDFYLRFSSEADMPTALAAFYKQDYTTVVDPETGEESTQIEGDPYLVQFTPDYAIDVVGVIYKPTGGTVTDPDGNEVPEMAPLDGWHINIRLMGDGRRDDVEALSAYFVDPEPATPSRVWL
Ga0208645_112453623300025853AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGDARREDVEAL
Ga0208544_1007799533300025887AqueousMIEEQTTPLEDQATRTDFYLKLASEAEMPTTLAAFYKQDYTTIVDPETGEESTQVEGSPYLVQTTADYAIDVVGVIHKPTGVTLTDADGSECPEMAPLDGWHVNLRLSGDNKRADA
Ga0208644_105963573300025889AqueousLKLASEADMPTALAAFYRQDTETTVDGETGEETVINVGDPYLVSHTADYAIDVVGIIYKPTGNILTDADGFEYEETAPLDGWHINLRLNGDARRADAEALSAYFVDPEPATPSRVWL
Ga0208644_106980123300025889AqueousVTEEVIEAPQRDFYIKLNAEADMPSVFAAFYTQDYVTVVDEEGVETQTPDGDPYLVAHTHDYAIDIVGVIQKPTGNVITDAEGNEIPEMAPVAGHHVNVRLTNDNRRDDVEAINAIYGQAPTTPERVFL
Ga0208644_110077913300025889AqueousMTDKIIEAPKTDFYLKLASEDDMPTALVAFYKQDYTTIVDPNTGEEVTQLEGSPYLVQNTSDYAIDVVGTIWKPTGVMLADDIPEMKALDGWHINIRLNGDARRADVEALSAYFVDPEPITPSRVWL
Ga0208644_120193213300025889AqueousIKLPSEADLPTAFAAFYKQDYVTVVDEETGESTQTPDGDAYLVTHSHDYAIDLVGVIHEPTGNMLTDDEGNEYPETAPVDGWHVNVRLVGDGRRVDIEDIDAVYGVTPNSPSRVFL
Ga0209536_10275913413300027917Marine SedimentMTEEPAVKTDFYIKLASEADMPTALAAFYRQDSSIVVDPETGEEHVQLEGDPYLVKHSPDHAIDIVGVIHEPTGNMLTDAEGNQYPETAPIQGWHINIRLCGDARRADVEAIDALYGVTPNSPSRVWL
Ga0348336_029310_1452_18173300034375AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEEAVTPDGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDAEGFEYPETAPLDGWHINIRLVGEARREDVEALDALYGVTPNSPRRVW
Ga0348337_166287_138_5033300034418AqueousMIDYYLKLNSEADMPTALAAFYRQDTITTVDPETGEETVTPEGDPYLVMHSPDYAIDIVGVIYDPTGNMLTDPEGFEYPETAPLDGWHINIRLVGDARRDDVEALDALYGVTPTSPRRVW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.