NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100976

Metagenome Family F100976

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100976
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 185 residues
Representative Sequence MFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.12 %
% of genes near scaffold ends (potentially truncated) 39.22 %
% of genes from short scaffolds (< 2000 bps) 53.92 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.098 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(40.196 % of family members)
Environment Ontology (ENVO) Unclassified
(83.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.137 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 21.88%    β-sheet: 27.08%    Coil/Unstructured: 51.04%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08291Peptidase_M15_3 26.47
PF03851UvdE 20.59
PF09834DUF2061 5.88
PF01464SLT 1.96
PF01909NTP_transf_2 0.98
PF04542Sigma70_r2 0.98
PF11019DUF2608 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG4294UV DNA damage repair endonucleaseReplication, recombination and repair [L] 20.59
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.08 %
UnclassifiedrootN/A3.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10193592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium571Open in IMG/M
3300002483|JGI25132J35274_1008107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2621Open in IMG/M
3300002514|JGI25133J35611_10025221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2290Open in IMG/M
3300002518|JGI25134J35505_10004163All Organisms → cellular organisms → Bacteria5411Open in IMG/M
3300002518|JGI25134J35505_10007937All Organisms → cellular organisms → Bacteria3687Open in IMG/M
3300006026|Ga0075478_10269093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300006027|Ga0075462_10232771All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium549Open in IMG/M
3300006736|Ga0098033_1001316All Organisms → cellular organisms → Bacteria10347Open in IMG/M
3300006738|Ga0098035_1018117All Organisms → cellular organisms → Bacteria2783Open in IMG/M
3300006751|Ga0098040_1157792All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium670Open in IMG/M
3300006752|Ga0098048_1000434Not Available20701Open in IMG/M
3300006793|Ga0098055_1008271All Organisms → cellular organisms → Bacteria4805Open in IMG/M
3300006802|Ga0070749_10007408All Organisms → cellular organisms → Bacteria7168Open in IMG/M
3300006802|Ga0070749_10029146All Organisms → cellular organisms → Bacteria3457Open in IMG/M
3300006810|Ga0070754_10184921All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300006810|Ga0070754_10322841All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium688Open in IMG/M
3300006869|Ga0075477_10037350All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2204Open in IMG/M
3300006870|Ga0075479_10036234All Organisms → cellular organisms → Bacteria2134Open in IMG/M
3300006916|Ga0070750_10017775All Organisms → cellular organisms → Bacteria3633Open in IMG/M
3300006916|Ga0070750_10138450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1107Open in IMG/M
3300006919|Ga0070746_10027456All Organisms → cellular organisms → Bacteria3085Open in IMG/M
3300006919|Ga0070746_10198749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.955Open in IMG/M
3300006924|Ga0098051_1007022All Organisms → cellular organisms → Bacteria3561Open in IMG/M
3300006929|Ga0098036_1112587All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium835Open in IMG/M
3300007234|Ga0075460_10309918All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium516Open in IMG/M
3300007276|Ga0070747_1030285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2152Open in IMG/M
3300007344|Ga0070745_1015606All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3471Open in IMG/M
3300007345|Ga0070752_1023281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3106Open in IMG/M
3300007538|Ga0099851_1030964All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2140Open in IMG/M
3300007539|Ga0099849_1012263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3811Open in IMG/M
3300007539|Ga0099849_1023692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2662Open in IMG/M
3300007539|Ga0099849_1090943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1224Open in IMG/M
3300007540|Ga0099847_1020065All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2180Open in IMG/M
3300007540|Ga0099847_1149955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium694Open in IMG/M
3300007541|Ga0099848_1023721All Organisms → cellular organisms → Bacteria → Proteobacteria2598Open in IMG/M
3300007542|Ga0099846_1014843All Organisms → cellular organisms → Bacteria3057Open in IMG/M
3300008012|Ga0075480_10034450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3043Open in IMG/M
3300009071|Ga0115566_10622563All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium603Open in IMG/M
3300009149|Ga0114918_10068465Not Available2300Open in IMG/M
3300009425|Ga0114997_10058062All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2462Open in IMG/M
3300009433|Ga0115545_1047031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1671Open in IMG/M
3300009435|Ga0115546_1127953All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium907Open in IMG/M
3300009476|Ga0115555_1201174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium821Open in IMG/M
3300009786|Ga0114999_11259765All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium525Open in IMG/M
3300010150|Ga0098056_1015272All Organisms → cellular organisms → Bacteria2774Open in IMG/M
3300010155|Ga0098047_10049100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1668Open in IMG/M
3300010297|Ga0129345_1074524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1275Open in IMG/M
3300010297|Ga0129345_1218468All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium672Open in IMG/M
3300010300|Ga0129351_1007310All Organisms → cellular organisms → Bacteria4588Open in IMG/M
3300010883|Ga0133547_11018088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1601Open in IMG/M
3300017702|Ga0181374_1009354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1785Open in IMG/M
3300017703|Ga0181367_1010880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1674Open in IMG/M
3300017703|Ga0181367_1031521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium952Open in IMG/M
3300017708|Ga0181369_1013946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2020Open in IMG/M
3300017746|Ga0181389_1163781All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium586Open in IMG/M
3300017775|Ga0181432_1090617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium902Open in IMG/M
3300017782|Ga0181380_1171354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium734Open in IMG/M
3300017783|Ga0181379_1196998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium706Open in IMG/M
3300017818|Ga0181565_10538607All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium755Open in IMG/M
3300017951|Ga0181577_10081536All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300017951|Ga0181577_10393676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium883Open in IMG/M
3300017952|Ga0181583_10010587All Organisms → cellular organisms → Bacteria → Proteobacteria6734Open in IMG/M
3300017956|Ga0181580_10434689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium868Open in IMG/M
3300017957|Ga0181571_10297681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1018Open in IMG/M
3300017958|Ga0181582_10018453All Organisms → cellular organisms → Bacteria → Proteobacteria5533Open in IMG/M
3300017969|Ga0181585_10793497All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300018049|Ga0181572_10873569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium533Open in IMG/M
3300018421|Ga0181592_10123785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1991Open in IMG/M
3300018426|Ga0181566_10740325All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium674Open in IMG/M
3300020165|Ga0206125_10000046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales154885Open in IMG/M
3300021958|Ga0222718_10003023All Organisms → cellular organisms → Bacteria14664Open in IMG/M
3300022057|Ga0212025_1020812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1063Open in IMG/M
3300022187|Ga0196899_1057874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1247Open in IMG/M
3300022200|Ga0196901_1039880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1794Open in IMG/M
3300022934|Ga0255781_10273599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium780Open in IMG/M
(restricted) 3300024255|Ga0233438_10039611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2514Open in IMG/M
(restricted) 3300024518|Ga0255048_10022825All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3210Open in IMG/M
(restricted) 3300024520|Ga0255047_10496328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium614Open in IMG/M
3300025066|Ga0208012_1002130All Organisms → cellular organisms → Bacteria4901Open in IMG/M
3300025070|Ga0208667_1001451All Organisms → cellular organisms → Bacteria8674Open in IMG/M
3300025072|Ga0208920_1004142All Organisms → cellular organisms → Bacteria3457Open in IMG/M
3300025072|Ga0208920_1006609All Organisms → cellular organisms → Bacteria2688Open in IMG/M
3300025097|Ga0208010_1054259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium885Open in IMG/M
3300025108|Ga0208793_1038466All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1540Open in IMG/M
3300025151|Ga0209645_1002578All Organisms → cellular organisms → Bacteria8571Open in IMG/M
3300025543|Ga0208303_1089810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium666Open in IMG/M
3300025647|Ga0208160_1034147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1524Open in IMG/M
3300025652|Ga0208134_1068071All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1067Open in IMG/M
3300025655|Ga0208795_1027442All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1822Open in IMG/M
3300025671|Ga0208898_1009075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5096Open in IMG/M
3300025674|Ga0208162_1005776Not Available5677Open in IMG/M
3300025674|Ga0208162_1038718All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1680Open in IMG/M
3300025751|Ga0208150_1061633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1264Open in IMG/M
3300025759|Ga0208899_1014426All Organisms → cellular organisms → Bacteria4202Open in IMG/M
3300025759|Ga0208899_1099086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1092Open in IMG/M
3300025769|Ga0208767_1006709All Organisms → cellular organisms → Bacteria7659Open in IMG/M
3300025803|Ga0208425_1118432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium607Open in IMG/M
3300025830|Ga0209832_1228257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium509Open in IMG/M
3300025869|Ga0209308_10239250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium784Open in IMG/M
3300027917|Ga0209536_100794811All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1172Open in IMG/M
3300031519|Ga0307488_10813399Not Available516Open in IMG/M
3300034374|Ga0348335_005778All Organisms → cellular organisms → Bacteria7584Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous40.20%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.47%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.76%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.92%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.94%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.98%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.98%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.98%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.98%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.98%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025097Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1019359213300000115MarineNEFPVEEVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLILKVWFSFFQMRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW*
JGI25132J35274_100810723300002483MarineMLVVLKQIWTNYQSLQKLINMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTISTDVLPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRIILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFVDKENKMKWCDYRMPTEIENRWDWAEQSAQRYNSEVLTGAMIEVASIEPDDTPVFGEVDTKVW*
JGI25133J35611_1002522143300002514MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGXRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
JGI25134J35505_1000416363300002518MarineMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLXGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNADVLAAAMIEVVGIKPDDTPIFGEIDRKIWHLEEGT*
JGI25134J35505_1000793763300002518MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGXRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHXVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0075478_1026909313300006026AqueousNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEKSAERYNAVPLTAAMTEIINIKPDDTPIF
Ga0075462_1023277113300006027AqueousIKLLYFFWNFIPNFGKWWYGLTMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGE
Ga0098033_100131683300006736MarineMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLSGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNADVLAAAMIEVVGIKPDDTPIFGEIDRKIWHLEEGT*
Ga0098035_101811733300006738MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0098040_115779213300006751MarineGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0098048_1000434233300006752MarineMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTVSTDVFSASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFVDKENKMKWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEIDTKVW*
Ga0098055_100827143300006793MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNIMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0070749_1000740843300006802AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIEKRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0070749_1002914663300006802AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWQGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW*
Ga0070754_1018492123300006810AqueousMFLVKILHFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0070754_1032284123300006810AqueousMKFLVKLLYLFWNVIPHFGKFWYSLTMEWSKNDKQYVEFAKSYEEIGERLGWGRKYRADKWDGKLDNLTHPTEIQKRILLNLDIGDCDDHAIYWATTLLKSDLVLKVWFSFFQMRSKSTGKLSGHVVCVFVDKENKMHWCDYRMPVEINNRWEWAEQ
Ga0075477_1003735013300006869AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIEKRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIRPDDTPIFGEIDKKIW*
Ga0075479_1003623423300006870AqueousMFLVKILHFLWNVIPNFARWWYSITMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0070750_1001777523300006916AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKTW*
Ga0070750_1013845013300006916AqueousMKFLTKLIYLFWWFIPRFAKFWYTLTMKLSKTISTDVLPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEVDTKVW*
Ga0070746_1002745633300006919AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEKSAERYNAVPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0070746_1019874923300006919AqueousLFWWFIPRFAKFWYTLTMKLSKTISTDVLPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEVDTKVW*
Ga0098051_100702243300006924MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHAVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0098036_111258723300006929MarineMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMVEVTSIKPDDTPVFGEVDKKIW*
Ga0075460_1030991813300007234AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEKSAERYNAVPLTA
Ga0070747_103028523300007276AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEEVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLILKVWFSFFQMRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW*
Ga0070745_101560623300007344AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIRPDDTPIFGEIDKKIW*
Ga0070752_102328143300007345AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIEKRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAVPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0099851_103096413300007538AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEV
Ga0099849_101226363300007539AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW*
Ga0099849_102369233300007539AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0099849_109094323300007539AqueousMILVKLLYFFWNIIPNFARCWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWDGKLDNLSHPTEIEKRISLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKLSGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMVEVVNIKPDDTPIFGEIDKKIW*
Ga0099847_102006513300007540AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW*
Ga0099847_114995513300007540AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSNNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKLSGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMVEVVNIKPDDTPIFGEIDKKIW*
Ga0099848_102372123300007541AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFSVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW*
Ga0099846_101484323300007542AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW*
Ga0075480_1003445023300008012AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW*
Ga0115566_1062256313300009071Pelagic MarineFFWNFIPKFGKWWYGLTMKVTKNNEFLVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKTW*
Ga0114918_1006846513300009149Deep SubsurfaceKWSRSDKHHVEIAKSYEEIGEKLHWGRKYRADKWDGKLDNLTHPTEIQKRILLNLDIGDCDDHAIYWATSLLKSDLVLKVWFSFFQMRSKKTGKLSGHVVCVFVDKENKMHWCDYRMPVEIQNRWEWAEQSAARYNSEVLTAAMIEVLEIKKDDTPIFGEIDKKTW*
Ga0114997_1005806253300009425MarineMFLIKLLYFFWNFIPSFAKWWYGLTMKVTKNDKFPVQKVSTYSQIGERLEWGRRYKEDKWGGKLDNLSHPTEIEKRISLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSEIEGRWEWAEQSAERYNAEVLTAAMIEVTGIKPDDTPIFGEVDRKIW*
Ga0115545_104703123300009433Pelagic MarineMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKTW*
Ga0115546_112795313300009435Pelagic MarineMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWSWAEQSAERYNAEVLTAAMIEVTSIKPD
Ga0115555_120117413300009476Pelagic MarineMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEEVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW*
Ga0114999_1125976513300009786MarineGLTMKVTKNDRFPVQKVSTYSQIGERLKWGQRYREDKWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRDTGKLSGHVVCVFVDKENRMKWCDYRMPSDIEERWQWAEQSAERYNADVLTAAMIEVVGIKPDDTPIFGEIDRKVWHQEE
Ga0098056_101527233300010150MarineMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK*
Ga0098047_1004910033300010155MarineMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTVSTDVFSASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFVDKENKMKWCDYRMPTEIENRWDWAEQSAQRYNSEVLTA
Ga0129345_107452413300010297Freshwater To Marine Saline GradientMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW*
Ga0129345_121846813300010297Freshwater To Marine Saline GradientMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIIN
Ga0129351_100731033300010300Freshwater To Marine Saline GradientMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFSVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW*
Ga0133547_1101808833300010883MarineFPVQKVSTYSQIGERLKWGQRYREDKWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRDTGKLSGHVVCVFVDKENRMKWCDYRMPSDIEERWQWAEQSAERYNADVLTAAMIEVVGIKPDDTPIFGEIDRKVWHQEEGT*
Ga0181374_100935443300017702MarineYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLSGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNADVLAAAMIEVVGIKPDDTPIFGEIDRKIWHLEEGT
Ga0181367_101088013300017703MarineMKILLKLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHAVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK
Ga0181367_103152123300017703MarineLKENKETMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLSGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNADVLAAAMIEVVGIKPDDTPIFGEIDRKIWHLEEGT
Ga0181369_101394613300017708MarineMKFLTKLIYLFWWFIPRFAKFWYTLTMKLSKTISTDVFLASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRIVLDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEVDTKVW
Ga0181389_116378113300017746SeawaterIMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW
Ga0181432_109061723300017775SeawaterMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDKWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRDTGKLSGHVVCVFVDKENRMKWCDYRMPSDIEERWQWAE
Ga0181380_117135423300017782SeawaterMKFSKTISTDVFPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRIILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEIDTKAW
Ga0181379_119699813300017783SeawaterMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTISTDVFPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRIILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAGQSAQRYNSEVLTAAMIEVA
Ga0181565_1053860713300017818Salt MarshLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKAW
Ga0181577_1008153623300017951Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Ga0181577_1039367623300017951Salt MarshMFLVKILHFLWNVIPNFARWWYGITMKLSKNKEFPVRTAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIRPDDTPIFGEIDKKIW
Ga0181583_1001058723300017952Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFLVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW
Ga0181580_1043468913300017956Salt MarshMFLVKILHFLWNVIPNFARWWYGITMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIRPDDTPIFGEIDKKIW
Ga0181571_1029768113300017957Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWRDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Ga0181582_1001845323300017958Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW
Ga0181585_1079349713300017969Salt MarshMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPTEIEGRWDWAEQSAERYNAVPLTAAMTEIINIRPDDTPIFGEIDKKIW
Ga0181572_1087356913300018049Salt MarshMFLVKILHFLWNVIPNFARWWYGITMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAER
Ga0181592_1012378533300018421Salt MarshFWNIIPNFSRWRYSLTMKLSKNKEFPVRKAAPYRQFGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW
Ga0181566_1074032523300018426Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLT
Ga0206125_10000046793300020165SeawaterMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWSWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW
Ga0222718_10003023143300021958Estuarine WaterMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGRLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Ga0212025_102081213300022057AqueousFWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIRPDDTPIFGEIDKKIW
Ga0196899_105787423300022187AqueousMFLVKLLYFFWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEKSAERYNAVPLTAAMTEIINIKPDDTPIFGEIDKKIW
Ga0196901_103988043300022200AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAA
Ga0255781_1027359913300022934Salt MarshMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKAW
(restricted) Ga0233438_1003961133300024255SeawaterMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMVEVISIKPDDTPVFGEVDKKIW
(restricted) Ga0255048_1002282513300024518SeawaterMKILLRLLYFIWNFVGVGMWWYTLTMKFSKNRHFQVMPIDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRMLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRKPKEITSRWNWAEQSAELYGAKPITAAMVHVVEIKD
(restricted) Ga0255047_1049632813300024520SeawaterVMPIDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRMLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRKPKEITSRWNWAEQSAELYGAKPITAAMVHVVEIKDDDTPVFGKIDKKIWKY
Ga0208012_100213033300025066MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHAVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK
Ga0208667_100145183300025070MarineMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTVSTDVFSASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFVDKENKMKWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEIDTKVW
Ga0208920_100414243300025072MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNVMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK
Ga0208920_100660923300025072MarineMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLSGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNADVLAAAMIEVVGIKPDDTPIFGEIDRKIWHLEEGT
Ga0208010_105425913300025097MarineMFLIKLLYFFWNFIPNFAKWWYGLTMKLTKNDDFPVQKVSTYSQIGERLKWGQRYREDEWGGKLDNLSHPTEIERRASLGYLIGDCDDHAIYWATSLLKSDLVLKVFFSFYQKRSRNTGKLSGHVVCVFVDKENRMKWCDYRMPSDIKERWQWAEQSAERYNAD
Ga0208793_103846633300025108MarineMKILLRLLYFIWNFVGVGMWWYSLTMKFSKNRHFSVTPVDQAWKIADRLDWGRRYRKDKWDGKLDNLTHPTEIQRRIDRTLEIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMQNKETGKLSGHVVCVFVDKDNIMKWCDYRRPKEITSRWNWAEQSAELYGAKPITAAMVHITEIREDDTPVFGDIDKKVWK
Ga0209645_100257873300025151MarineMKFLTKLIYLFWWFIPRFAKFWYTLTMKFSKTISTDVLPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRIILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFVDKENKMKWCDYRMPTEIENRWDWAEQSAQRYNSEVLTGAMIEVASIEPDDTPVFGEVDTKVW
Ga0208303_108981013300025543AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKLSGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMVEVVNIKPDDTPIFGEIDKKIW
Ga0208160_103414733300025647AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIK
Ga0208134_106807113300025652AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEEVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISI
Ga0208795_102744213300025655AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKVW
Ga0208898_100907593300025671AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIEKRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQ
Ga0208162_100577643300025674AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNKEFPVEKVSTYSEVGERLEWGRRYRKDKWEGKLDNLSHPTEIQKRIFNGELIGDCDDHAIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Ga0208162_103871823300025674AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW
Ga0208150_106163323300025751AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW
Ga0208899_101442623300025759AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKIW
Ga0208899_109908613300025759AqueousMKFLTKLIYLFWWFIPRFAKFWYTLTMKLSKTISTDVLPASSYQEIGERLSWGKRYRADKWDGKLDNLTHPTEIQKRVILDKDIGDCDDHAIYWATCLLKSDLVLKVWFSFYQMKSKETGKLSGHVVCVFIDKENKMQWCDYRMPTEIENRWDWAEQSAQRYNSEVLTAAMIEVASIEPDDTPVFGEVDTKVW
Ga0208767_100670933300025769AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEVDKKTW
Ga0208425_111843213300025803AqueousMFLIKLLYFFWNFIPNFGKWWYGLTMKLTKNNEFSVDKVSSYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIVNGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERYNAEVLTAAMIEVVSIKPGDTPVFGEV
Ga0209832_122825713300025830Pelagic MarineIPNFGKWWYGLTMKVTKNNEFPVEEVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSDIESRWGWAEQSAERYNAEVLTAAMVEVISIKPDDTP
Ga0209308_1023925023300025869Pelagic MarineMFLIKLLYFFWNFIPNFGKWWYGLTMKVTKNNEFPVEKVSTYSEVGERLEWGKRYRKDKWEGKLDNLSHPTEIQKRIANGELIGDCDDHSIYWATCLLKSDLVLKVWFSFFQMRSRDTRKLSGHVVCVFIDKENKMKWCDYRMPSDIESRWDWAEQSAERY
Ga0209536_10079481133300027917Marine SedimentMFLVKILHFLWNVIPNFARWWYGITMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIERRIGMGELIGDCDDHAIYWATSLVKSDLVLKVWFSFFQMRSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAVPLT
Ga0307488_1081339913300031519Sackhole BrineEKIMFLIKLLYFFWNFIPSFAKWWYGLTMKLTKNDDFPVEEVSAYSEVGERLEWGRRYRKDKWDGKLDNLSHPTEIQKRINTGELIGDCDDHSIYWAACLLKSDLVLKVFFSFFQMRSKDTGKLSGHVVCVFVDKENKMKWCDYRMPSEIEGRWEWAEQSAERYNAEVLTA
Ga0348335_005778_3101_36793300034374AqueousMVLVKLLYFLWNIIPNFARWWYSLTMKLSKNKEFPVRKAASYRQIGERLDWGRRYKKDKWNGKLDNLSHPTEIEKRIGLGELIGDCDDHAIYWATSLVKSDLVLKVWFCFFQMQSKETGKISGHVVCVFIDKENKLKWCDYRMPSEIEGRWDWAEQSAERYNAEPLTAAMTEIINIKPDDTPIFGEIDKKIW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.