NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101015

Metagenome Family F101015

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101015
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 95 residues
Representative Sequence MAGTGTPEANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQIGDSK
Number of Associated Samples 59
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 58.82 %
% of genes near scaffold ends (potentially truncated) 22.55 %
% of genes from short scaffolds (< 2000 bps) 58.82 %
Associated GOLD sequencing projects 56
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.039 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(25.490 % of family members)
Environment Ontology (ENVO) Unclassified
(40.196 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.020 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.29%    β-sheet: 0.00%    Coil/Unstructured: 38.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08843AbiEii 3.92
PF13649Methyltransf_25 3.92
PF13470PIN_3 2.94
PF04055Radical_SAM 2.94
PF00271Helicase_C 2.94
PF00266Aminotran_5 2.94
PF00155Aminotran_1_2 1.96
PF04367DUF502 1.96
PF00691OmpA 1.96
PF00069Pkinase 1.96
PF00884Sulfatase 1.96
PF13091PLDc_2 0.98
PF13426PAS_9 0.98
PF02744GalP_UDP_tr_C 0.98
PF02837Glyco_hydro_2_N 0.98
PF04542Sigma70_r2 0.98
PF00334NDK 0.98
PF07075DUF1343 0.98
PF13860FlgD_ig 0.98
PF00180Iso_dh 0.98
PF00528BPD_transp_1 0.98
PF00150Cellulase 0.98
PF00754F5_F8_type_C 0.98
PF13692Glyco_trans_1_4 0.98
PF14535AMP-binding_C_2 0.98
PF00990GGDEF 0.98
PF14534DUF4440 0.98
PF00210Ferritin 0.98
PF01066CDP-OH_P_transf 0.98
PF08241Methyltransf_11 0.98
PF08240ADH_N 0.98
PF11617Cu-binding_MopE 0.98
PF13231PMT_2 0.98
PF04977DivIC 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.84
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 3.92
COG2928Uncharacterized membrane proteinFunction unknown [S] 1.96
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 0.98
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.98
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.98
COG2919Cell division protein FtsBCell cycle control, cell division, chromosome partitioning [D] 0.98
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.98
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.98
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.98
COG4839Cell division protein FtsLCell cycle control, cell division, chromosome partitioning [D] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.04 %
UnclassifiedrootN/A1.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_129625_len_15031_cov_8_721576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria15081Open in IMG/M
2124908040|B4_c_ConsensusfromContig69846Not Available3378Open in IMG/M
2140918008|ConsensusfromContig203693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1931Open in IMG/M
3300001213|JGIcombinedJ13530_108950808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium876Open in IMG/M
3300005831|Ga0074471_10166095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2897Open in IMG/M
3300005905|Ga0075269_10096651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300006642|Ga0075521_10054295All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300009029|Ga0066793_10010244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4933Open in IMG/M
3300009630|Ga0116114_1045652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300009641|Ga0116120_1051377All Organisms → cellular organisms → Bacteria → Proteobacteria1417Open in IMG/M
3300009694|Ga0116170_10560620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300012204|Ga0137374_11199160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
(restricted) 3300013127|Ga0172365_10006481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8656Open in IMG/M
(restricted) 3300013128|Ga0172366_10033765All Organisms → cellular organisms → Bacteria3703Open in IMG/M
3300014490|Ga0182010_10000371All Organisms → cellular organisms → Bacteria25826Open in IMG/M
3300014490|Ga0182010_10031615All Organisms → cellular organisms → Bacteria2454Open in IMG/M
3300014490|Ga0182010_10113918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1366Open in IMG/M
3300014494|Ga0182017_10000045All Organisms → cellular organisms → Bacteria86058Open in IMG/M
3300014494|Ga0182017_10000369All Organisms → cellular organisms → Bacteria35070Open in IMG/M
3300014494|Ga0182017_10024691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4124Open in IMG/M
3300014494|Ga0182017_10054030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2675Open in IMG/M
3300014494|Ga0182017_10260599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300014496|Ga0182011_10000981All Organisms → cellular organisms → Bacteria25079Open in IMG/M
3300014496|Ga0182011_10022854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4539Open in IMG/M
3300014496|Ga0182011_10184072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1428Open in IMG/M
3300014498|Ga0182019_10040361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2659Open in IMG/M
3300014498|Ga0182019_10381503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300014498|Ga0182019_10859179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300014498|Ga0182019_11084185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300014502|Ga0182021_10001118All Organisms → cellular organisms → Bacteria30475Open in IMG/M
3300014502|Ga0182021_10021780All Organisms → cellular organisms → Bacteria7581Open in IMG/M
3300014502|Ga0182021_10146917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2743Open in IMG/M
3300014502|Ga0182021_10279151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1963Open in IMG/M
3300014839|Ga0182027_10007670All Organisms → cellular organisms → Bacteria15846Open in IMG/M
3300014839|Ga0182027_10036558All Organisms → cellular organisms → Bacteria6312Open in IMG/M
3300014839|Ga0182027_10075439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4125Open in IMG/M
3300018008|Ga0187888_1003068All Organisms → cellular organisms → Bacteria13436Open in IMG/M
3300019785|Ga0182022_1312249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1031Open in IMG/M
3300019788|Ga0182028_1254656All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300019788|Ga0182028_1313360Not Available2980Open in IMG/M
3300019788|Ga0182028_1374909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2148Open in IMG/M
3300022516|Ga0224542_1032958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300022520|Ga0224538_1003159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1548Open in IMG/M
3300025461|Ga0208851_1036588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium894Open in IMG/M
3300025498|Ga0208819_1127290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300026381|Ga0255357_1071446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300028556|Ga0265337_1054052All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300028653|Ga0265323_10007398All Organisms → cellular organisms → Bacteria4566Open in IMG/M
3300028653|Ga0265323_10028793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2081Open in IMG/M
3300028653|Ga0265323_10060148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1323Open in IMG/M
3300028869|Ga0302263_10376949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300029957|Ga0265324_10056220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1348Open in IMG/M
3300029984|Ga0311332_10070700All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300029984|Ga0311332_10616926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium858Open in IMG/M
3300029989|Ga0311365_10510233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300029989|Ga0311365_11121917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300030000|Ga0311337_11140979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300030002|Ga0311350_11815912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300030114|Ga0311333_10156115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1747Open in IMG/M
3300030114|Ga0311333_10567405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300030114|Ga0311333_10749929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300030294|Ga0311349_10006981All Organisms → cellular organisms → Bacteria9917Open in IMG/M
3300030294|Ga0311349_11079333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300030838|Ga0311335_10070771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2204Open in IMG/M
3300030838|Ga0311335_10257247All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300031232|Ga0302323_100007608All Organisms → cellular organisms → Bacteria8975Open in IMG/M
3300031232|Ga0302323_100079478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3105Open in IMG/M
3300031232|Ga0302323_101197280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium849Open in IMG/M
3300031235|Ga0265330_10000729All Organisms → cellular organisms → Bacteria20694Open in IMG/M
3300031235|Ga0265330_10009195All Organisms → cellular organisms → Bacteria4706Open in IMG/M
3300031235|Ga0265330_10012703All Organisms → cellular organisms → Bacteria3934Open in IMG/M
3300031235|Ga0265330_10055819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1724Open in IMG/M
3300031235|Ga0265330_10206622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium830Open in IMG/M
3300031344|Ga0265316_10053236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3172Open in IMG/M
3300031344|Ga0265316_10072290All Organisms → cellular organisms → Bacteria2657Open in IMG/M
3300031344|Ga0265316_10136110All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300031344|Ga0265316_10604378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium777Open in IMG/M
3300031712|Ga0265342_10029023All Organisms → cellular organisms → Bacteria3438Open in IMG/M
3300031712|Ga0265342_10700398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300031722|Ga0311351_11596061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300031726|Ga0302321_100158731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2330Open in IMG/M
3300031726|Ga0302321_100200775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2084Open in IMG/M
3300031726|Ga0302321_101085320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium914Open in IMG/M
3300031726|Ga0302321_101375168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300031902|Ga0302322_101383173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300031902|Ga0302322_102393305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300031902|Ga0302322_103420948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300032770|Ga0335085_11899197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300032829|Ga0335070_10601019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1035Open in IMG/M
3300032897|Ga0335071_10201680All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1943Open in IMG/M
3300032897|Ga0335071_11201121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300033433|Ga0326726_10979986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300033487|Ga0316630_10729478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300033521|Ga0316616_103137378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300033743|Ga0334844_000055All Organisms → cellular organisms → Bacteria23871Open in IMG/M
3300033797|Ga0334815_008380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1091Open in IMG/M
3300033797|Ga0334815_015412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium861Open in IMG/M
3300033798|Ga0334821_009108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2049Open in IMG/M
3300033825|Ga0334843_027972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi762Open in IMG/M
3300033891|Ga0334811_080277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium847Open in IMG/M
3300034127|Ga0370489_0193483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300034195|Ga0370501_0002613All Organisms → cellular organisms → Bacteria4439Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen25.49%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen24.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere15.69%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.98%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.98%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.98%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.98%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908040Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300022516Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34EnvironmentalOpen in IMG/M
3300022520Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026381Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T-25EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300033797Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-SEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033825Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_009716902124908028SoilMAGTGTPEANLQAENLRLAEQVRALSGDEHTRREAAPWRNATPAERVAETWRLCARVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQTGDGK
B4_c_049149902124908040SoilMPRXANPDADLXTENERLFAQVQAXSGXDHIRREAAPXCXATPXERVAATWRLCALVPWXRXLWPEDVRQRADXXXXXPXXTXXLLEXLKQAGRRK
Bog_all_C_045976902140918008SoilMPRNANPDADLATENERLFAQVQALSGDDHIRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLPADTLVLLERLKQAGRRK
JGIcombinedJ13530_10895080813300001213WetlandMSSRASLDRQLQAENLRLAEQVRTMSGDDHRQREAAPWRDATPEERLAETWRLCSLVPWLQSLWPEEVRARVEQREPLPASALAILEDLKRAREPVR*
Ga0074471_1016609533300005831Sediment (Intertidal)MAGPLETNLQAENLRLAEQVRVLSGADHLRREAEPWRNATPEERLAETWRLCALVPWFRSLWPEDVRARADAPELLPASTVAILERLKQACEAR*
Ga0075269_1009665123300005905Rice Paddy SoilLYRPRAHGRSRLLLMACPTVSEANLQAENPRLAEQVRAFSGDEHVRREAAPWRDASPAERVAQTWRLCALVPWFRSLWPEDVRARADVPEPLPASTVAVLERLKQEGDGR*
Ga0075521_1005429523300006642Arctic Peat SoilMDPVVLPDATLQVENRRLAEQIRSLSGEEHLWREAAPWRDATPEERVAETWRLCALVPWFRSLWPADVRSRAEIPEPLPADTVAILERMKQRAR*
Ga0066793_1001024433300009029Prmafrost SoilMAGTGTPEANLQVENLRLAEQVRALSGDEHTRREAAPWRDAMPEERVAETWRLCALVPWFRSLWPEDVRARADAPVPLPANTLAILERFKQAGGGR*
Ga0116114_104565223300009630PeatlandMAGTGMPDPNLQSENLRLAEQVRVFSGDEHVRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGSGK*
Ga0116120_105137723300009641PeatlandMAGTGMTDPNLQSENLRLAEQVRVFSGDEHVRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGSGK*
Ga0116170_1056062023300009694Anaerobic Digestor SludgeMSNAAAPQPPLQAENLRLAEQVRTMSGDEHLARETATWRDATPEERLAETWRLCALVPWLQSLWPEEVRARAEQPEPLPASTLAILENLKRAGARG*
Ga0137374_1119916013300012204Vadose Zone SoilMDPAALPEATLQRENRRLAEQIRSLSGEDHLRREAAPWRNATAEERVAETWRLCALVPWFRSLWPADVRARAETPEPLPADTVTILERMKQAPGKP*
(restricted) Ga0172365_1000648183300013127SedimentVARADRSKADLQAENLRLAEQVRTLSGDAQLLRETAPWRDATPEERVAETWRLAALVPWFRSLWPEEVRLRADAPEPLPADTLAVLERLKRSGGRG*
(restricted) Ga0172366_1003376563300013128SedimentVARADRSKADLQAENLRLAEQVRTLSGDAQLLRETAPWRDANPEERVAETWRLAALVPWFRSLWPEEVRLRADAPEPLPADTLAVLERLKRSGGRG*
Ga0182010_10000371273300014490FenMPRHANPGTDLALENERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE*
Ga0182010_1003161543300014490FenMAGTPDGSFRTENLGLAEQVRMLSGSDHLRREAEPWRNATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEALPPSTVAILERLKQAGETK*
Ga0182010_1011391823300014490FenMPRNANLGADLATENQRLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLEGLKQAGRRE*
Ga0182017_10000045473300014494FenMAGNANQGADLARENERLAAQVQALSGDDHIRRAAAPWCDATPAERVAATWRLCALVPWFRSLWPEEVRQRADQPEPLPADSLALLERLKQIGGRE*
Ga0182017_10000369163300014494FenMVMAGTGTPEANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPTERVAETWRLCALVPWFRSLWPEDVRARAEAPDPMPASTLAILERLKQEGDSK*
Ga0182017_1002469123300014494FenMAGPGTPELNLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPELLPASTLAILERLKQAGDGK*
Ga0182017_1005403043300014494FenMPRNANRGVNLATENERLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRRE*
Ga0182017_1026059923300014494FenMAGSGTLEANLQAENLRLAEQVRALSGDKHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQIGDSK*
Ga0182011_1000098133300014496FenMPRNANPGADLATENQRLAAQVQALSGDDYIRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLPADSLALLERLKQAGRRE*
Ga0182011_1002285423300014496FenMAGPGTPELNLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPAPLPASTLAILERFKQVGDGK*
Ga0182011_1018407233300014496FenMPHGADLTTENERLAAQVQALSGDDHIRREAAPWCDATPAERVAATWSLCALVFWFRSLWPEDVRQRADQPEPLPADTLALLERLKQAGTRG*
Ga0182019_1004036123300014498FenMAGVPEANLQAENLRLAEQVRVLSGDVHVRREAAPWRDATPEERLAETWRLCALVPWFRSLWPEDVCARADAPESLPASTMAILERLKKTGEKR*
Ga0182019_1038150323300014498FenMSGGSTSDARLQAENRRLAEQVRAFSGDEQLRREAAAWRDATPEERIAETWRLCALVPWFRSLWPEDVQRRADDAPGLPEDTSAILERMKRAGVEK*
Ga0182019_1085917923300014498FenMPRNANQGADLATENERLAAQVQALSGDEHARREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADSLALLERLKQAGRRE*
Ga0182019_1108418523300014498FenMDPAASPDATLQKENRRLAEQIRSLSGEEHLWREAAPWRDATPEERVAETWRLCALVPWFRSLWPADVRSRAEIPEPLPADTVAILERMKQRAR*
Ga0182021_1000111883300014502FenMAGTGTPDANLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQSEGGK*
Ga0182021_1002178063300014502FenMAGTGTPEANLQAENLRLAEQVRALSGDEHLRHEAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQIGDSK*
Ga0182021_1014691743300014502FenMPRNANQGADLATENERLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRRE*
Ga0182021_1027915113300014502FenMAGPGTPDPNLQAENMRLAEQVRVFSGDEHIRREAATWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPELLPASTLAILERLKQAGDGK*
Ga0182027_1000767043300014839FenMAGTGTTEASLRRENLRLAEQVRALSGDEHIRRESAPWRVATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTMAILEQLKQSGGTR*
Ga0182027_1003655883300014839FenMIGPGALEAELQAENSRLAEQVRALSGDEHLRREAAPWRDATPAERLAETWRLCALVPWFRSLWPENVRARADAPEALPASTVAILERLKRTGDGR*
Ga0182027_1007543923300014839FenMPRNANLGADLATENQRLAAQVQALSGDEHTRREAAPWCYATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRRE*
Ga0187888_1003068103300018008PeatlandMAGTGMPDPNLQSENLRLAEQVRVFSGDEHVRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGSGK
Ga0182022_131224943300019785FenDLATENERLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRHE
Ga0182028_125465623300019788FenMAGPGTPELNLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPAPLPASTLAILERFKQVGDGK
Ga0182028_131336053300019788FenMAGPGTPELNLQAENLRLAEQVRACLGTNIFAASRAWRDATPAERVAETWRLCALVPWFRIALARGRARARRRARAAAGEHPGDSRAVSSR
Ga0182028_137490913300019788FenMAGPGTPELNLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFPIALARGRARARRRARAAAASTLAILERFKQVGDGK
Ga0224542_103295813300022516SoilSLSHRLSTNRGRLFSMPRHANPGTDLALENERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE
Ga0224538_100315933300022520SoilMPRHANPGTDLALENERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE
Ga0208851_103658813300025461Arctic Peat SoilMSGTPETNLQAENLRLAEQVRVLSGDNHLRREAAPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADTPESLPASTVAILE
Ga0208819_112729023300025498PeatlandMAGTGMTDPNLQSENLRLAEQVRVFSGDEHVRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGSGK
Ga0255357_107144623300026381SoilMAGPGTPDPNLQAENMRLAEQVRVFSGDEHIRREAATWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPELLPASTLAILERLKQAGDGK
Ga0265337_105405223300028556RhizosphereLAEQIRALSGEDHLWREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARAETPEPLPADTVAILERMKQTSGKP
Ga0265323_1000739833300028653RhizosphereMVGTPEASLQTENLRLAEQVRALSGDEHIRRESAPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTMAILERLKQSGGTR
Ga0265323_1002879333300028653RhizosphereMAGTGTPDVNLQAENLRLAEQVRVFSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAVFERFKQAGGAK
Ga0265323_1006014813300028653RhizosphereGTPDPNLQAENLRLAEQVRVFSGDEHIRREAATWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGDGK
Ga0302263_1037694913300028869FenALMAGTGTPEANLQVENLRLAEQVRALSGDEHTRREAAPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAAEPLPANTLAILERFKQAGGGR
Ga0265324_1005622023300029957RhizosphereMDPAASPDATLQKENRRLAEQIRSLSGEDHLWREAAPWRDATPEERVAETWRLCALVPWFRSLWPADVRSRAEIPEPLPADTVVILERMKQRAR
Ga0311332_1007070033300029984FenMAGNANQGADLARENERLAAQVQALSGDDHIRRAAAPWCDATPAERVAATWRLCALVPWFRSLWPEEVRQRADQPEPLPADSLALLERLKQIGGRE
Ga0311332_1061692613300029984FenMAGTPDVSLQAENLRLAEQVRVLSGDDHVRREARPWRDATPEERVAETWRLCALVPWFRSLWPADIRARADAPESLPLSTLVILERLKQAGEAR
Ga0311365_1051023333300029989FenRLSTNRGRLFSMPRHANPGTDLALENERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE
Ga0311365_1112191713300029989FenMAGTGTPEANLQVENLRLAEQVRALSGDEHTRREAAPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAAEPLPANTLAILERFKQAGGGR
Ga0311337_1114097923300030000FenMAGNANQGADLARENERLAAQVQALSGDDHIRRAAAPWCDATPAERVAATWRLCALVPWFRSLWPEEVRQRADQPAPLPADSLALLERLKQIGGRE
Ga0311350_1181591213300030002FenRGIGSPIRANCGRLAAMAGNANQGADLARENERLAAQVQALSGDDHIRRAAAPWCDATPAERVAATWRLCALVPWFRSLWPEEVRQRADQPEPLPADSLALLERLKQIGGRE
Ga0311333_1015611533300030114FenMAGTPEANLQAENQRLAEQVRMLSGDAHLRREAEPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADAPKPLPASTMAILERLKKSGEKG
Ga0311333_1056740513300030114FenMAGTGTLDANLQAENSRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQSEGGK
Ga0311333_1074992913300030114FenVSPFSLSHRLSTNRGRLFSMPRHANPGTDLALENERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE
Ga0311349_1000698153300030294FenMAGTGTPDANLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQSEGGK
Ga0311349_1107933323300030294FenMAGTPDANMQAENLRLAEQVRVLSGDDHIRREAAPWRNATPEERLAETWRLCGLVPWFRSLWPEDVRARADVPEALPAGTMAILERLKQAGQKG
Ga0311335_1007077133300030838FenMSGTPETNLQAENLRLAEQVRVLSGDDHLRREAAPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADTPESLPASTVAILERLKLSGEAK
Ga0311335_1025724723300030838FenMAGTDSPSATSQAENLRLAEQVRVLSGDYHLRREVEPWRDATPEERLQETWRLCALVPWFRSLWPIDVRARADAHESLPANTLAVLEWLKQAGERP
Ga0302323_100007608113300031232FenMSGTPETNLQAENLRLAEQVRVLSGDDHLRREAAPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADTPESLPASTVAILERLKL
Ga0302323_10007947823300031232FenMAGTDSPSATSQAENLRLAEQVRVLSGDDHLRREVEPWRDATPEERLQETWRLCALVPWFRSLWPIDVRARADAHESLPANTLAVLEWLKQAGERP
Ga0302323_10119728023300031232FenMASPDAPEANLQRENLRLVEQVRVMSGDEHLRREATPWRNATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTVAILERLKQTGEAK
Ga0265330_10000729143300031235RhizosphereMAGTDTPDANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEEVRARADAPEPLPASTLAILERLKQAGDGK
Ga0265330_1000919523300031235RhizosphereMAGTGTPEANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPVPLPANTLAILERLKQIGDSK
Ga0265330_1001270333300031235RhizosphereMAGPGTPDPNLQAENLRLAEQVRVFSGDEHIRREAATWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQAGDGK
Ga0265330_1005581923300031235RhizosphereMAGTGTPDVNLQAENLRLAEQVRVFSGDEHIRCEAAPWRDATSAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAVFERFKQAGGAK
Ga0265330_1020662233300031235RhizosphereMSGGSTSDARLQAENRRLAEQVRAFSGDEQLRREAAAWRDATPEERIAETWRLCALVPWFRSLWPEEVRRRADAAPGLPEDTSAILERMKRAGVEK
Ga0265316_1005323613300031344RhizosphereMTGPGALEADLQAENSRLAEQVRALSGDEQLRREAAPWRDATPAERLAETWRLCALVPWFRSLWPEDVRARADAPEVLPASTLAILERLKRTGDGR
Ga0265316_1007229033300031344RhizosphereMPHGADLTTENERLAAQVQALSGDDHIRREAAPWCDATPAERVAATWRLCALVPWFRSLWPEDVRQRADQPDPLPADTLALLERLKQAGTRG
Ga0265316_1013611023300031344RhizosphereMVGMPEANLQAENLRLAEQVRVLSGDIHVRREATPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADAPESLPASTMAILERLKKSGEKG
Ga0265316_1060437823300031344RhizosphereMPRNANRGADLATENERLAAQVQALSGDEHARREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRRE
Ga0265342_1002902313300031712RhizosphereKENRRLAEQIRALSGEDHLWREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARAETPEPLPADTVAILERMKQTSGKP
Ga0265342_1070039823300031712RhizosphereVSGTLEANLQVENLRLAEQVRASSGDVHLRREAEPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAPESLPDSTIAILERLKKSGEKE
Ga0311351_1159606113300031722FenANLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTLAILERLKQSEGGK
Ga0302321_10015873113300031726FenMAGTGTPEANLQVENLRLAEQVRALSGDEHTRREAAPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAAEPLPA
Ga0302321_10020077543300031726FenMQAENLRLAEQVRVLSGDDHIRREAAPWRNATPEERLAETWRLCGLVPWFRSLWPEDVRARADVPEALPAGTMAILERLKQAGQKG
Ga0302321_10108532013300031726FenMAGTGTPEANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQIGDSK
Ga0302321_10137516813300031726FenMASPDAPEANLQRENLRLAEQVRVMSGDEHLRREATPWRNATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTVAILERLKQTGEAK
Ga0302322_10138317313300031902FenMAGTGTPEANLQAENLRLAEQVRALSGDEHLRHEAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQIGDSK
Ga0302322_10239330523300031902FenMPRNANLGADLATENQRLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLEGLKQAGRRE
Ga0302322_10342094813300031902FenMAGMPDVSLQAENLRLAEQVRVLSGDDHVRREARPWRDATPEERVAETWRLCALVPCFRSLWPADIRARADAPESLPVSTLVILERLKQAGEAR
Ga0335085_1189919713300032770SoilMALSGVSEANLQAENLRLAEQVRALSGDEHIRREAAPWRDATPEERLAETWRLCALVPWFRSLWPADVRARADAPEPLPPSTLEILERL
Ga0335070_1060101913300032829SoilMALSGVSEANLQAENLRLAEQVRALSGDEHIRREAAPWRDATPEERLAETWRLCALVPWFRSLWPADVRARADAPEPLPPSTLEILERLKREGDKG
Ga0335071_1020168023300032897SoilMAVMDTPEANLQAENSRLAEQVRALSGDEYVRREAAVWRDATPEERVAETWRLCALVPWFRSLWPEDVRTRADAPDALPANTLAILERLKQEGEKR
Ga0335071_1120112123300032897SoilMCRALSCDPLLQAENLRLTEQVRALSGDQQLVREAAPWRDATPEERLAETWRLCSLVPWLQSLWPEDVRVRAEQPEPLPASALAILENLKRAGTGK
Ga0326726_1097998623300033433Peat SoilMAPHWQLDCGRLREMLANVSADLTRENQRLAAQVQALSGDDHVRCEAAPWCDATPAERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLPADTLALLERLKQAERRG
Ga0316630_1072947823300033487SoilGMPEAHLQAENLRLAEQVQVLSGNDHVRREAEPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAPELLPADTLAILERLKQAGEEA
Ga0316616_10313737823300033521SoilMTGMPKAHLQAENLRLAEQVQVLSGNDHVRREAEPWRDATPEERVAETWRLCALVPWFRSLWPEDVRARADAPELLPADTLAILERLKQAGEEA
Ga0334844_000055_3531_38213300033743SoilMAGPGTPDPNLQAENLRLAEQVRALSGDEHIRREAAPWRDATPAERVAETWRLCDLVPWFRSLWPEDVRARADAPELLPASTLAILERLKQAGDGK
Ga0334815_008380_571_8613300033797SoilMPRNANRGADLATENERLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADSLALLERLKQAGRRE
Ga0334815_015412_96_3743300033797SoilMPHGADLTTENERLAAQVQALSGDDHIRREAAPWCDATPAERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLPADTLALLERLKQAGTRG
Ga0334821_009108_1804_20493300033798SoilERLAAQVQALSGDEHIRREAAPWCDATPEERLAATWSLCALVPWFRSLWPEDVRQRAEQPEPLPADTVALLERLKQAGRRE
Ga0334843_027972_1_2403300033825SoilMVGMPEANLQAENLRLAEQVRVLSGDIHVRCEATPWRDATPEERLAETWRLCALVPWFRSLWPEDVRARADAPESLPAST
Ga0334811_080277_467_7573300033891SoilMPRNANQGADLATENERLAAQVQALSGDEHTRREAAPWCDATPEERVAATWRLCALVPWFRSLWPEDVRQRADQPEPLSADTLALLERLKQAGRRE
Ga0370489_0193483_2_2533300034127Untreated Peat SoilENLRLAEQVRALSGDEHLRREAALWRNATPEERVAETWRLCALVPWFRSLWPEDVRARADAPEPLPASTMAILERLKRAGETR
Ga0370501_0002613_978_12683300034195Untreated Peat SoilMAGTGTPEANLQAENLRLAEQVRALSGDEHLRREAAPWRDATPAERVAETWRLCALVPWFRSLWPADVRARADAPEPLPASTLAILERLKQMGDSK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.