NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101200

Metagenome / Metatranscriptome Family F101200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101200
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 51 residues
Representative Sequence MGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Number of Associated Samples 91
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 11.11 %
% of genes near scaffold ends (potentially truncated) 73.53 %
% of genes from short scaffolds (< 2000 bps) 93.14 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.078 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(27.451 % of family members)
Environment Ontology (ENVO) Unclassified
(68.627 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(58.824 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.67%    β-sheet: 0.00%    Coil/Unstructured: 77.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00026Asp 35.29
PF00676E1_dh 0.98
PF01250Ribosomal_S6 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0360Ribosomal protein S6Translation, ribosomal structure and biogenesis [J] 0.98
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.98
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.08 %
UnclassifiedrootN/A3.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10225894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300004784|Ga0007744_1275346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300005516|Ga0066831_10020024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1825Open in IMG/M
3300005941|Ga0070743_10315192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300006415|Ga0099654_10058083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300007513|Ga0105019_1053422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2407Open in IMG/M
3300008952|Ga0115651_1122141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1889Open in IMG/M
3300009071|Ga0115566_10415642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300009080|Ga0102815_10440273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300009263|Ga0103872_1019099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300009265|Ga0103873_1023234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1045Open in IMG/M
3300009436|Ga0115008_10540419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium835Open in IMG/M
3300009436|Ga0115008_10680227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300009592|Ga0115101_1820520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2082Open in IMG/M
3300009599|Ga0115103_1025951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300009677|Ga0115104_10506407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300009677|Ga0115104_10952196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300009679|Ga0115105_10700969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300009705|Ga0115000_10513653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300012954|Ga0163111_10992714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum810Open in IMG/M
3300016751|Ga0182062_1351841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300017731|Ga0181416_1078581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300018428|Ga0181568_11265141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018730|Ga0192967_1048183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300018741|Ga0193534_1050179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018846|Ga0193253_1013416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1721Open in IMG/M
3300018979|Ga0193540_10114862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300018981|Ga0192968_10015190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2019Open in IMG/M
3300018982|Ga0192947_10066314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1158Open in IMG/M
3300019021|Ga0192982_10183882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300019032|Ga0192869_10064518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1292Open in IMG/M
3300019039|Ga0193123_10360230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300019048|Ga0192981_10033050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1735Open in IMG/M
3300019050|Ga0192966_10135993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum867Open in IMG/M
3300019050|Ga0192966_10145034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum841Open in IMG/M
3300019051|Ga0192826_10280461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300019103|Ga0192946_1038101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300020182|Ga0206129_10236203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300020422|Ga0211702_10255782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300020436|Ga0211708_10431705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300021342|Ga0206691_1683795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300021359|Ga0206689_10209378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum752Open in IMG/M
3300021872|Ga0063132_104629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1800Open in IMG/M
3300021887|Ga0063105_1060486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300021889|Ga0063089_1099983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021912|Ga0063133_1042982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300022074|Ga0224906_1186085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300025694|Ga0209406_1138608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300025869|Ga0209308_10247807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300025890|Ga0209631_10119509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1478Open in IMG/M
3300026398|Ga0247606_1016953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300026458|Ga0247578_1047523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium820Open in IMG/M
3300026461|Ga0247600_1067090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300026465|Ga0247588_1060835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300026468|Ga0247603_1024814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1137Open in IMG/M
3300026500|Ga0247592_1177188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300027771|Ga0209279_10133542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300028119|Ga0247561_112296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300028279|Ga0228613_1064904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300028282|Ga0256413_1154090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300028282|Ga0256413_1368799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300028335|Ga0247566_1081510Not Available547Open in IMG/M
3300028595|Ga0272440_1036671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2152Open in IMG/M
3300030671|Ga0307403_10391472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300030671|Ga0307403_10429717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300030671|Ga0307403_10574238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300030699|Ga0307398_10338093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300030756|Ga0073968_11350935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300030786|Ga0073966_11800262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300030958|Ga0073971_11085634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300031032|Ga0073980_11342783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031037|Ga0073979_12310520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium961Open in IMG/M
3300031216|Ga0307980_1076097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300031542|Ga0308149_1026996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300031542|Ga0308149_1055202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031569|Ga0307489_10830485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300031626|Ga0302121_10101464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium845Open in IMG/M
3300031710|Ga0307386_10633531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300031725|Ga0307381_10092652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium983Open in IMG/M
3300031729|Ga0307391_10468460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300031729|Ga0307391_10583841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300031729|Ga0307391_10744708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300031738|Ga0307384_10290429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium743Open in IMG/M
3300031739|Ga0307383_10617087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300031750|Ga0307389_10690023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300032491|Ga0314675_10457565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300032518|Ga0314689_10420469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300032519|Ga0314676_10391290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium826Open in IMG/M
3300032540|Ga0314682_10464569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300032616|Ga0314671_10448237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300032651|Ga0314685_10137002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1270Open in IMG/M
3300032651|Ga0314685_10420645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300032713|Ga0314690_10365066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300032713|Ga0314690_10606406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300032728|Ga0314696_10255786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium893Open in IMG/M
3300032730|Ga0314699_10229768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium824Open in IMG/M
3300032734|Ga0314706_10199147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium950Open in IMG/M
3300032743|Ga0314707_10370830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300032750|Ga0314708_10506982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine27.45%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.55%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater14.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.94%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.96%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.96%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.98%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.98%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.98%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.98%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.98%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.98%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.98%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.98%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026398Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1022589423300000128MarineDHAMVSFSVTSQEMGETPYALFGGYNSSQIVGGGNGLKTFKNYENWLGTWALEGQGMYYGA*
Ga0007744_127534623300004784Freshwater LakeSITSKEMGETPYALFGGYNSSQIVGGAQGLKTFKNFENWLGTWALEG*
Ga0066831_1002002443300005516MarineMNETPYALFGGYNSSQIVNGVDGLKTFKNFPNWLGTWALEGQGMTYGAKAM*
Ga0070743_1031519223300005941EstuarineGMADHSYALFGGYNSSQIVNGAYGLKVFRNYPNSMRTWALQG*
Ga0099654_1005808333300006415LakeCSSDLETPYALFGGYNSTQIVGGSKGLKTFKNFPNWLGTWSLEG*
Ga0105019_105342223300007513MarineMVSFSITSQEMGENPYALFGGYNSSQIVGGASGLKTFKNYPNWLGTWALEG*
Ga0115651_112214133300008952MarineMVSFSITSQEMGESPYALFGGYNSSQIVGGASGLKTFKNYPNWLGTWALEG*
Ga0115566_1041564213300009071Pelagic MarineIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG*
Ga0102815_1044027313300009080EstuarineMGEAPYALFGGYNSSQIVGGGEGLKTFRNFENWLGTWALE
Ga0103872_101909923300009263Surface Ocean WaterMGETPYALFGGYNSTQIVGGAEGLKTFKNFQNWLGTWALEGQGMYYG*
Ga0103873_102323423300009265Surface Ocean WaterMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNFQNWLGTWALEGQGMYYG*
Ga0115008_1054041923300009436MarineMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM*
Ga0115008_1068022733300009436MarineALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG*
Ga0115101_182052033300009592MarineMKDKPYALFGGYNSSQIVNGAAGLKTFKNYKNEYQTWSLLGQGMTYGGDYATAPTDK*
Ga0115103_102595113300009599MarineMKQHGMADSIVSFSLTYASMKDHPYALFGGYNSSQIVGGASGLKTFKNFPNKM*
Ga0115104_1050640713300009677MarineVSFSITSKEMNQTPYALFGGYNSTQIVGGAKGLKSSKHFENWLGTWALEGQGMMYGAKPM
Ga0115104_1095219613300009677MarineMGESPYALFGGYNSSQIVGGASGLKTFKNYPNWLGTWALEG*
Ga0115105_1070096913300009679MarineYALFGGYNSSQIVGGSQGLKTFKNFPNWLGTWALEG*
Ga0115000_1051365313300009705MarineFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEGQGMTYGSKAMQQVG*
Ga0163111_1099271433300012954Surface SeawaterFGGYNSSQIVDGAAGLKTFKNFPNWLGTWALEGQGMTYG*
Ga0182062_135184113300016751Salt MarshMVSFSVTSQDMGETPYALFGGYNSSQIVGGANGLKTFKNYENWLGTWALEGQGMYYGATPMQK
Ga0181416_107858123300017731SeawaterETPYALFGGYNSSQIVGGAEGLKTFKNFPNWLGTWALEGQGMYYG
Ga0181568_1126514113300018428Salt MarshMVSFSVTSQDMGETPYALFGGYNSSQIVGGANGLKTFKNYENWLGTWALEGQGMYYGATPMQKPGED
Ga0192967_104818313300018730MarineVSFSVTSKEMNETPYALFGGYNSSQIVGGAQGLKTFKSFPNWLGTWALEG
Ga0193534_105017913300018741MarineVTSKEMNETPYALFGGYNSTQIVNGADGLKTFKNFPNWLGTWALEGQGMTYGSKAM
Ga0193000_106862913300018745MarineGGYNSTQIVNGAEGLKTFKNFENWLGTWALEGQGMYYGNKPM
Ga0193253_101341623300018846MarineMKDKPYALFGGYNSSQIVNGAAGLKTFKNYKNEYQTWSLLGQGMTYGGDYATAPTDK
Ga0193540_1011486213300018979MarineMGNETPYALFGGYNSTQIVNGADGLKTFKNFPNWLGTWALEGQGMTYGSKAM
Ga0192968_1001519023300018981MarineMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMFYGGKAMQ
Ga0192947_1006631423300018982MarineMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0192982_1018388233300019021MarineALVSFSVTSKEMNETPYALFGGYNSSQIVDGAAGLKTFKNFPNWLGTWALEG
Ga0192869_1006451823300019032MarineVSFSVTSKEMNETPYALFGGYNSTQIVGGSEGLKTFKSFPNWLGTWALEGQGMTYGSVAM
Ga0193123_1036023023300019039MarineSVTSKEMNETPYALFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEG
Ga0192981_1003305023300019048MarineMKERPYALFGGYNSTQIVNGAAGLKTFKNYPNRLETWSLLG
Ga0192966_1013599313300019050MarineIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0192966_1014503433300019050MarineHGTSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0192826_1028046123300019051MarineALFGGYNSTQIVNGADGLKTFKNFPNWLGTWALEGQGMTYGAKAM
Ga0192946_103810113300019103MarineVTSKEMNETPYALFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEG
Ga0206129_1023620313300020182SeawaterITSKEMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Ga0211702_1025578223300020422MarineYALFGGYNSTQIVGGSSGLKTFMNYPNWLETWALKGQGLYYNGVTVQDPEE
Ga0211708_1043170513300020436MarineMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYY
Ga0206691_168379513300021342SeawaterQDMGETPYALFGGYNSTQIVGGAGGLKTFKNYPNWLGTWALEG
Ga0206689_1020937833300021359SeawaterDNAMVSFSVTSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNFPNWLGTWALEG
Ga0063132_10462933300021872MarineMVSFSVTSKEMNETPYALFGGYNSSQIVGGTQGLKTFKNFPNWLGTWALEGQGMTYGAKS
Ga0063105_106048613300021887MarineALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Ga0063089_109998313300021889MarineFSVTSKEMNETPYALFGGYNSSQIVNGAEGLKTFKNFPNWLGTWALEG
Ga0063133_104298213300021912MarineTPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0224906_118608523300022074SeawaterGIIDHAMVSFSVTSKDMTDAPYALFGGYNSSQIVGGASGLKSFKNYENWLGTWALEGQGTYYGGKTM
Ga0209406_113860833300025694Pelagic MarineSITSKEMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Ga0209308_1024780713300025869Pelagic MarineMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYG
Ga0209631_1011950933300025890Pelagic MarineMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEGQGMNYGG
Ga0247606_101695313300026398SeawaterFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEGQGMNYGG
Ga0247578_104752323300026458SeawaterMNETPYALFGGYNSTQIVGGSEGLKTFKSFPNWLGTWAL
Ga0247600_106709013300026461SeawaterNETPYALFGGYNSTQIANGADGLKTFKNFPNWLGTWALEGQGMTYGAKAM
Ga0247588_106083523300026465SeawaterFSVTSKEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEG
Ga0247603_102481423300026468SeawaterMVSFSITSKEMGETPYALFGGYNSTQIVGGAAGLKTFKNFPNWLGTWALEGQGMYYGQKPMQ
Ga0247592_117718813300026500SeawaterMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLKTFKNFQNWLGTWALEGKGMYYGSKPMQ
Ga0209279_1013354223300027771MarineMKDKPYALFGGYNSSQIVNGAAGLKTFKNFKNEYQTWTLLGQGM
Ga0247561_11229623300028119SeawaterVTSKEMNETPYALFGGYNSTQIVNGADGLKTFKNFPNWLGTWALE
Ga0228613_106490413300028279SeawaterIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEG
Ga0256413_115409023300028282SeawaterFSVTSKEMGETPYALFGGYNSSQIVGGAEGLKTFKNFPNWLGTWALEG
Ga0256413_136879913300028282SeawaterPYALFGGYNSSQIVNGAAGLKTFKNYKNEYQTWSLLGQGMTYGGDYATAPTDK
Ga0247566_108151013300028335SeawaterEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGIKI
Ga0272440_103667133300028595Marine SedimentMGEGPYALFGGYNSSQIVGGAEGLKTFRNYPNWLGTWALEG
Ga0307403_1039147213300030671MarineRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0307403_1042971723300030671MarineMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKA
Ga0307403_1057423813300030671MarineIDKPMVSFSISSRDQMDDSYALFGGINSTQIVGGAEGIHSFPSFPNFLGTWALEG
Ga0307398_1033809313300030699MarineKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0073968_1135093513300030756MarineMGETPYALFGGYNSTQIVNGAEGLKTFKNFENWLGTWALEGQG
Ga0073966_1180026223300030786MarineMGETPYALFGGYNSTQIVGGAQGLKTFKNFENWLGTWALEGQGMYYADKPMQKPGED
Ga0073971_1108563413300030958MarineEMNETPYALFGGYNSSQIVGGQAGLKTFKNYPNWLGTWALEGQGMMYGDKSM
Ga0073980_1134278323300031032MarineMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYAGNAL
Ga0073979_1231052023300031037MarineMKENSYALFGGYNSTQIVDGASGLKTFKNHPNTFKTWSLLGQGMTYGS
Ga0307980_107609713300031216Saline WaterEMGETPYALFGGYNSSQIEGGSDGLKTFKNFNNWLGTWALEG
Ga0308149_102699613300031542MarineEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEG
Ga0308149_105520213300031542MarineNGIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0307489_1083048513300031569Sackhole BrineEMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEG
Ga0302121_1010146413300031626MarineSFSVTSKEMNETPYALFGGYNSSQIVNGAEGLKTFKNFPNWLGTWALEG
Ga0307386_1063353113300031710MarineNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGSQGLKTFKNFPNWLGTWALEG
Ga0307381_1009265223300031725MarineMGETPYALFGGYNSTQIVNGAEGLKTFKNFENWLGTWALEGQGMFYGGKPMQNPG
Ga0307391_1046846023300031729MarineVSFSVTSKEMGETPYALFGGYNSTQIVGGAEGLKSFKNFPNWLGTWALEGQGMTYGAEAIQKPG
Ga0307391_1058384113300031729MarineMNDKPYALFGGYNSSQILGGASGLKTFKNYKNWLGTWALEAEGMTY
Ga0307391_1074470813300031729MarineMVSFSVTSQDMGENPYALFGGYNSTQIVGGAQGLKTFKNFENWLGTWALEGQGMYYGGNA
Ga0307384_1029042923300031738MarineVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGLKSFKNFPNWLGTWALEG
Ga0307383_1061708713300031739MarineMGESPYALFGGYNSSQIVGGAAGLKTFKNFANWLGTWALEGQGMYYGAEPMQKPGDDT
Ga0307389_1069002313300031750MarinePYALFGGYNSSQIVNGAEGLKTFKNFPNWLGTWALEG
Ga0314675_1045756523300032491SeawaterVSFSVTSKEMNETPYALFGGYNSSQIVNGADGLKTFKNFPNWLGTWALEGQGMTYGSKAM
Ga0314689_1042046923300032518SeawaterFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0314676_1039129013300032519SeawaterRAMVSFSITQNGMKENSYALFGGYNSTQIVGGASGLKTFKNHPNTFNTWSLLG
Ga0314682_1046456913300032540SeawaterINQTGTDKPYALFGGYNSSQIVGGAKGLKTFKRYLNRLGTWALEGQSTFYGKQ
Ga0314671_1044823723300032616SeawaterYALFGGYNSSQIVGGSKGLKTFKRYLNRLGTWALEGQNTFYGNQAIQKPD
Ga0314685_1013700223300032651SeawaterMNETPYALFGGYNSSQIVDGAAGLKTFKNFPNWLGTWALEGQGMTYGQKPMQTAGQD
Ga0314685_1042064523300032651SeawaterITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0314690_1036506613300032713SeawaterVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0314690_1060640613300032713SeawaterMVSFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYG
Ga0314696_1025578623300032728SeawaterMVRFSITSREMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKA
Ga0314699_1022976813300032730SeawaterAMVSFSITQNGMKENSYALFGGYNSTQIVGGASGVKTFKNYPNTYNTWSLLG
Ga0314706_1019914713300032734SeawaterMGETPYALFGGYNSTQIVGGAEGLKTFKNFENWLGTWALEGQGMYYGGKAM
Ga0314707_1037083023300032743SeawaterGLIDRAMVSFSITQNGMKENSYALFGGYNSTQIVGGASGLKTFKNHPNTFNTWSLLG
Ga0314701_1032461523300032746SeawaterYALFGGYNSTQIVGGASGLKTFKNYPNTYNTWSLLG
Ga0314708_1050698223300032750SeawaterMNETPYALFGGYNSSQIVDGAAGLKTFKNFPNWLGTWALEGQGMTYGQKPMQTAGQDTS
Ga0334989_0295724_180_3053300033984FreshwaterMNDKPYALFGGYNSSQILYGTQGIKMFKNYPNEFNTWALKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.