Basic Information | |
---|---|
Family ID | F101214 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 39 residues |
Representative Sequence | MIEFDYTETITGPQIQMLKEGLKESELSEEQIKELEQ |
Number of Associated Samples | 57 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 84.31 % |
% of genes near scaffold ends (potentially truncated) | 16.67 % |
% of genes from short scaffolds (< 2000 bps) | 84.31 % |
Associated GOLD sequencing projects | 45 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (80.392 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water (24.510 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.471 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF03889 | ArfA | 48.04 |
PF00166 | Cpn10 | 5.88 |
PF10263 | SprT-like | 1.96 |
PF04820 | Trp_halogenase | 1.96 |
PF12705 | PDDEXK_1 | 1.96 |
PF13759 | 2OG-FeII_Oxy_5 | 1.96 |
PF08291 | Peptidase_M15_3 | 0.98 |
PF01832 | Glucosaminidase | 0.98 |
PF11246 | Phage_gp53 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG3036 | Stalled ribosome alternative rescue factor ArfA | Translation, ribosomal structure and biogenesis [J] | 48.04 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 5.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 80.39 % |
All Organisms | root | All Organisms | 19.61 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 24.51% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.57% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 17.65% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 9.80% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.88% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 5.88% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.90% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.90% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.96% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.98% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.98% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026123 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_101474533 | 3300000116 | Marine | MIEFDYTETITGPQIQMLXEGLKESELSEEQIKEQENG* |
DelMOSpr2010_102271053 | 3300000116 | Marine | MKIEFDYTETITGPQIQLLKEGLKESEMSDDEIENAEKE* |
DelMOWin2010_100104445 | 3300000117 | Marine | MIKFDYTETITGPQIQILKEGLKESELTEEEIKELEL* |
DelMOWin2010_100944542 | 3300000117 | Marine | MKIEFDYTETLTGPQIQMLRKGLKESEMTDEEVENGEDN* |
DelMOWin2010_102203623 | 3300000117 | Marine | MIEFDYTETITGPQIQMLREGLKESELSEEQIKEQENG* |
JGI11772J19994_10394472 | 3300001748 | Saline Water And Sediment | MKIEFDYTETITGPQIQLLKEGLKESELTEEEIKELEL* |
Ga0055584_1007551833 | 3300004097 | Pelagic Marine | MEWNSMKIEFDYTETITGPQIQILKEGLKLSELSEEEIKELEE* |
Ga0074648_10979042 | 3300005512 | Saline Water And Sediment | MKIEFDYTETITGPQIQMLKEGLKESELSEDELKEKENG* |
Ga0075517_14295513 | 3300006393 | Aqueous | MKVEFDYTETITGPQIQMLKEGLKQSEMSDEEIENAEKE* |
Ga0075503_10161344 | 3300006400 | Aqueous | MKVEFDYTETITGPQIQMLKEGLKQSELSEEQIKEQENG* |
Ga0070749_100302186 | 3300006802 | Aqueous | MEIEFDYTEVLTGQQVNILREGLKQSELTEEELKEE* |
Ga0070749_102273623 | 3300006802 | Aqueous | MIEFDYTETITGPQIQMLKEGLKESELSEEQIKELEQ* |
Ga0070749_102833263 | 3300006802 | Aqueous | MKIEFDYTETITGPQIQILKEGLKQSELSEEEIKELEE* |
Ga0070749_106637942 | 3300006802 | Aqueous | MKIEFDYTETITGPQIQILKEGLKESELSEEQIKEQENG*I* |
Ga0070749_107506032 | 3300006802 | Aqueous | MIKFDYTETITGPQIQILKEGLKESELTEEEIKELEL*EKH* |
Ga0075477_103928972 | 3300006869 | Aqueous | MKIEFDYTETITGPQIQILKEGLKQSEMSDEEIENAEKE* |
Ga0070750_100975205 | 3300006916 | Aqueous | MECYSMIKFDYTETITGPQIQILKEGLKESELTEEEIKELEL* |
Ga0070746_101407774 | 3300006919 | Aqueous | MIEFDYTETITGPQIQMLKEGLKESELSEEQINELEQ* |
Ga0070746_101671095 | 3300006919 | Aqueous | FDYTETITGPQIQMLKEGLKESELTEEELKELEQ* |
Ga0099849_11762944 | 3300007539 | Aqueous | MIIEFDYTETITGPQIQMLKEGLKESELSEEQIKEQENG* |
Ga0102945_10249424 | 3300007609 | Pond Water | MKIEFDYTETITGPQIQMLKEGLKKSELSEDELKEKENG* |
Ga0102948_100524711 | 3300007623 | Water | MIEFDYTETITGPQIQMLREGLKESEMSDEEILNAEKN* |
Ga0102951_12207521 | 3300007725 | Water | NSMIDFDYTETITGPQIHMLKEGLKESELSEEQLKELEE* |
Ga0102954_10827132 | 3300007778 | Water | MIIEFDYTETITGPQIQMLREGLKESELSEEQIKELEQ* |
Ga0102954_11035402 | 3300007778 | Water | MIEFDYRETITGPQIQILKEGLKESELTEDEVQEIDNG* |
Ga0102960_10309694 | 3300009000 | Pond Water | MIDFDYTETITGPQIHMLKEGLKESELSEEQLKELEE* |
Ga0102960_10328684 | 3300009000 | Pond Water | MIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQ* |
Ga0102960_10770594 | 3300009000 | Pond Water | MIEFDYTETITGPQIQILKEGLKESELTEDEIKEIDNG* |
Ga0102960_10981711 | 3300009000 | Pond Water | IEFDYTETITGPQIQMLKEGLKQSELSEEEIKELEE* |
Ga0102960_11213732 | 3300009000 | Pond Water | MIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNG* |
Ga0102963_10560393 | 3300009001 | Pond Water | MIGFDYTETITGPQIQMLKEGLKQSELSEEEIKELEE* |
Ga0102963_13571702 | 3300009001 | Pond Water | MIEFDYTETITGPQIHMLKEGLKESELTEEELKELEQ* |
Ga0129351_12566914 | 3300010300 | Freshwater To Marine Saline Gradient | MKIEFDYTEIITGPQIQLLKEGLKESEMSDDEIENAEKE* |
Ga0182092_13332252 | 3300016734 | Salt Marsh | MIIEFDYTETITGPQIQMLKEGLKESELSEEQIKELEQ |
Ga0182076_11951332 | 3300016739 | Salt Marsh | MIIEFDYTETITGPQIQMLKEGLKESESSEEQLKELEQXEKH |
Ga0181552_103191791 | 3300017824 | Salt Marsh | MEWNSMKVEFDYTETITGPQIQMLKEGLKESELSEEQIKEQENG |
Ga0181584_102967442 | 3300017949 | Salt Marsh | MIIEFDYTETITGPQIQMLREGLKESELSEEQIKELEQ |
Ga0181584_105426531 | 3300017949 | Salt Marsh | MIIEFDYTETITGPQIQILKEGLKQSEMSDEEIEN |
Ga0181584_107209802 | 3300017949 | Salt Marsh | MIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQXEKH |
Ga0181581_101677763 | 3300017962 | Salt Marsh | MIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQ |
Ga0181581_104167964 | 3300017962 | Salt Marsh | MEWNSMIEFDYTETITGPQIQLLKEGLKESELSDNEVKELENES |
Ga0181553_103237213 | 3300018416 | Salt Marsh | MKVEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQ |
Ga0181592_103813022 | 3300018421 | Salt Marsh | MKIEFDYTETITGPQIQILKDGLKESELSDNEVQELENES |
Ga0181591_107347692 | 3300018424 | Salt Marsh | MKIEFDYTETITGPQIQILKDGLKESELSDNEVEELENEN |
Ga0194016_10186191 | 3300019708 | Sediment | MEWNSMKVEFDYTETITGPQIQMLKEGLKESELSEEQIKEQENGXI |
Ga0194023_10400532 | 3300019756 | Freshwater | MKVEFDYTETITGPQIQILKEGLKQSEMSDEEIENVEKE |
Ga0194024_10478683 | 3300019765 | Freshwater | MIKFDYTETITGPQIQILKEGLKESELTEEEIKELEL |
Ga0194024_11340962 | 3300019765 | Freshwater | MKIEFDYTETITGPQIQMLREGLKESELSEEQIKEQENGXI |
Ga0194022_10462892 | 3300019937 | Freshwater | MIEFDYTETITGPQIQMLREGLKESELSEEQIKEQENGXI |
Ga0194032_10069684 | 3300019938 | Freshwater | MKVEFDYTETITGPQIQMLKEGLKESELCEEQIKEQENGXI |
Ga0181599_100097345 | 3300020178 | Salt Marsh | MIIEFDYTETITGPQIQMLREGLKESELSEEQIKELEQXEKH |
Ga0213858_100119268 | 3300021356 | Seawater | MIEFDYTETITGPQIQMLREGLKESELSEEQIKELEQ |
Ga0213858_101532835 | 3300021356 | Seawater | NSMKIEFDYTETITGPQIQILKEGLKQSELSEEEIKELEQ |
Ga0213858_101614103 | 3300021356 | Seawater | MIEFDYTETITGPQIQILKEGLKQSELSEEEIKELEQ |
Ga0213858_101630385 | 3300021356 | Seawater | RYSMIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQ |
Ga0213858_105134942 | 3300021356 | Seawater | MKIEFDYTETITGPQIQLLKKGLKESEMSDDEIENAEKE |
Ga0213859_102131724 | 3300021364 | Seawater | MIEFDYTETITGPQIQMLKEGLKESELSEEQIKELEQXEKH |
Ga0222717_100306789 | 3300021957 | Estuarine Water | MIEFDYTETITGPQIQMLREGLKESEMSDEEILNAEKN |
Ga0222717_100612741 | 3300021957 | Estuarine Water | MIEFDYRETITGPQIQILKEGLKESELTEDEVQEIDN |
Ga0222717_101672233 | 3300021957 | Estuarine Water | MIDFDYTETITGPQIHMLKEGLKESELSEEQLKELEE |
Ga0222717_102494831 | 3300021957 | Estuarine Water | KMERYSMIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQ |
Ga0222718_100284654 | 3300021958 | Estuarine Water | MIEFDYTETITGPQIQILKEGLKESELTDDEVKELENGI |
Ga0222718_100475035 | 3300021958 | Estuarine Water | MIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNG |
Ga0222718_100607003 | 3300021958 | Estuarine Water | MIEFDYTETITGPQIQMLREGLKESELSEEQLKELEQ |
Ga0222718_101063603 | 3300021958 | Estuarine Water | MEWNSMIDFDYTETITGPQIHMLKEGLKESELSEEQLKELEE |
Ga0222718_102514874 | 3300021958 | Estuarine Water | MIEFDYTETITGPQIQMLKEGLKESELTEDEVKEIDNGXI |
Ga0222718_105703343 | 3300021958 | Estuarine Water | RMEWNSMIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNGXV |
Ga0222718_106033131 | 3300021958 | Estuarine Water | MEWNSMIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQ |
Ga0222718_106033191 | 3300021958 | Estuarine Water | MIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQ |
Ga0222716_101186006 | 3300021959 | Estuarine Water | MEWNSMIEFDYTETITGPQIHMLKEGLKESELTDEQ |
Ga0222716_103610144 | 3300021959 | Estuarine Water | MIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNGXV |
Ga0222715_100716953 | 3300021960 | Estuarine Water | MEWNSMIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNG |
Ga0222715_100743054 | 3300021960 | Estuarine Water | MIEFDYTETITGPQIHMLKEGLKESELTDEQLKELENENSDN |
Ga0222715_101714115 | 3300021960 | Estuarine Water | MEWNSMIEFDYTETITGPQIQMLKEGLKQSELSEEEIKELEE |
Ga0222715_103306842 | 3300021960 | Estuarine Water | MEWNSMIIEFDYTETITGPQIQMLKEGLKESELSEEQIKELEK |
Ga0222714_100834383 | 3300021961 | Estuarine Water | MEWISMIIEFDYTETITGPQIQMLREGLKESELSEEQIKELEQ |
Ga0222714_104331843 | 3300021961 | Estuarine Water | MEWNSMIEFDYTETITGPQIHMLKEGLKESELTEE |
Ga0222713_103049673 | 3300021962 | Estuarine Water | MEWNSMIEFDYTETITGPQIHMLKEGLKESELSEEQLKELEE |
Ga0222713_103309454 | 3300021962 | Estuarine Water | MIEFDYTETITGPQIKILKEGLEQSELSEEQIKEQDNGXI |
Ga0222719_103474822 | 3300021964 | Estuarine Water | MEWNSMIEFDYTETITGPQIQILKEGLKESELTEDEIKEIDNG |
Ga0222719_103530713 | 3300021964 | Estuarine Water | MEWNSMIGFDYTETITGPQIQMLKEGLKQSELSEEEIKELEE |
Ga0222719_104528172 | 3300021964 | Estuarine Water | MKIEFDYTETITGPQIQLLKEGLKESEMSDDEIENAEKE |
Ga0212024_10389233 | 3300022065 | Aqueous | MIKFDYTETITGPQIQILKEGLKESELTEEEIKELELXEKH |
Ga0212021_10190302 | 3300022068 | Aqueous | MEIEFDYTEVLTGQQVNILREGLKQSELTEEELKEE |
Ga0212021_10672273 | 3300022068 | Aqueous | MIEFDYTETITGPQIQMLREGLKESELSEEQIKEQENG |
Ga0212021_11152273 | 3300022068 | Aqueous | MKIEFDYTETLTGPQIQMLRKGLKESEMTDEEVENGEDN |
Ga0212026_10416413 | 3300022069 | Aqueous | MKVEFDYTETITGPQIQMLKEGLKESELSEEQIKEQENG |
Ga0255770_100244248 | 3300022937 | Salt Marsh | MIIEFDYTETITGPQIQMLREGLKESELSEEQLKELEQ |
Ga0255770_103248822 | 3300022937 | Salt Marsh | MKVEFDYTETITGPQIQILKEGLKQSEMSDEEIENAEKE |
Ga0255764_102602283 | 3300023081 | Salt Marsh | MKVEFDYTETITGPQIQMLKEGLKQSEMSDEEIENAEKE |
Ga0255751_100777124 | 3300023116 | Salt Marsh | MIIEFDYKETITGPQIQMLKEGLKESELSEEQLKELEQ |
Ga0255772_102533392 | 3300023176 | Salt Marsh | MKIEFDYTETITGPQIQILKDGLKESELSDNEVEELENES |
Ga0255772_103661024 | 3300023176 | Salt Marsh | MIIEFDYTETITGPQIQMLKEGLKESELSEEQLKELEQXDKH |
Ga0208898_10674332 | 3300025671 | Aqueous | MKVEFDYTETITGPQIQMLKEGLKESELSEEQIKEQENGXI |
Ga0208899_11143562 | 3300025759 | Aqueous | MIEFDYTETITGPQIQMLKEGLKESELTEEELKELEQXEKH |
Ga0208899_11288072 | 3300025759 | Aqueous | MECYSMIKFDYTETITGPQIQILKEGLKESELTEEEIKELEL |
Ga0208767_12582262 | 3300025769 | Aqueous | MIEFDYTETITGPQIQMLKEGLKQSELSEEQIKEQENGXI |
Ga0208644_11018042 | 3300025889 | Aqueous | MEWNSMIEFDYTETITGPQIQMLKEGLKQSELSEEQIKEQENG |
Ga0209953_10140204 | 3300026097 | Pond Water | MKIEFDYTETITGPQIQMLKEGLKKSELSEDELKEKENG |
Ga0209955_100135815 | 3300026123 | Water | MIEFDYRETITGPQIQILKEGLKESELTEDEVQEIDNG |
Ga0209962_10255941 | 3300026125 | Water | MEWNSMIEFDYTETITGPQIQMLREGLKESEMSDEEIL |
Ga0209929_11102483 | 3300026187 | Pond Water | MIEFDYTETITGPQIQMLKEGLKQSELSEEEIKELEE |
⦗Top⦘ |