NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101373

Metagenome / Metatranscriptome Family F101373

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101373
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence AIFLVIVLVSPGGLVGLWERVVNLFSGRRRGPLDRMPVELGQAEPTV
Number of Associated Samples 83
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.08 %
% of genes from short scaffolds (< 2000 bps) 98.04 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.039 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(22.549 % of family members)
Environment Ontology (ENVO) Unclassified
(34.314 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.882 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13458Peripla_BP_6 42.16
PF00005ABC_tran 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.04 %
UnclassifiedrootN/A1.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918006|ConsensusfromContig96472All Organisms → cellular organisms → Bacteria704Open in IMG/M
2199352024|deeps__Contig_104231All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300002568|C688J35102_117709562All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium500Open in IMG/M
3300004479|Ga0062595_101700810All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005181|Ga0066678_10377426All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005366|Ga0070659_101988772All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium522Open in IMG/M
3300005444|Ga0070694_101768312All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium526Open in IMG/M
3300005447|Ga0066689_10736650All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium615Open in IMG/M
3300005451|Ga0066681_10800312All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium569Open in IMG/M
3300005458|Ga0070681_10989386All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005467|Ga0070706_102062648All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005468|Ga0070707_100468432All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300005891|Ga0075283_1091766All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium562Open in IMG/M
3300006046|Ga0066652_101549005All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006237|Ga0097621_101740143All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006574|Ga0074056_11273351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300006953|Ga0074063_13402616All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium590Open in IMG/M
3300009012|Ga0066710_104917892All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009137|Ga0066709_101042459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1199Open in IMG/M
3300010039|Ga0126309_10034220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2335Open in IMG/M
3300010095|Ga0127475_1104666All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300010096|Ga0127473_1017036All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300010103|Ga0127500_1107718All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300010108|Ga0127474_1050591All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010115|Ga0127495_1103039All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010121|Ga0127438_1088413All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium888Open in IMG/M
3300010146|Ga0126320_1356037All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium787Open in IMG/M
3300010147|Ga0126319_1094135All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300010229|Ga0136218_1013817All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300010303|Ga0134082_10482941Not Available539Open in IMG/M
3300010320|Ga0134109_10367430All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010371|Ga0134125_11072079All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium882Open in IMG/M
3300010373|Ga0134128_12280435All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium596Open in IMG/M
3300010401|Ga0134121_13126477All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300010861|Ga0126349_1246784All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012189|Ga0137388_10633209All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300012212|Ga0150985_104104293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1095Open in IMG/M
3300012212|Ga0150985_104836585All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium554Open in IMG/M
3300012212|Ga0150985_105238669All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium549Open in IMG/M
3300012212|Ga0150985_112449041All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium509Open in IMG/M
3300012212|Ga0150985_113203039All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium788Open in IMG/M
3300012212|Ga0150985_118120099All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012212|Ga0150985_118134028All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium777Open in IMG/M
3300012212|Ga0150985_118307554All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300012212|Ga0150985_118666380All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012212|Ga0150985_122373226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1509Open in IMG/M
3300012212|Ga0150985_122881354All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300012356|Ga0137371_11158971All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012356|Ga0137371_11253965All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012379|Ga0134058_1059499All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium526Open in IMG/M
3300012379|Ga0134058_1170367All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012388|Ga0134031_1048225All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300012391|Ga0134035_1110228All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012397|Ga0134056_1190697All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012398|Ga0134051_1343752All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012399|Ga0134061_1109790All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium730Open in IMG/M
3300012401|Ga0134055_1134180All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium682Open in IMG/M
3300012402|Ga0134059_1093699All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012404|Ga0134024_1309842All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012406|Ga0134053_1169211All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012410|Ga0134060_1227446All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300012469|Ga0150984_103844571All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300012469|Ga0150984_104119611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1052Open in IMG/M
3300012469|Ga0150984_108352747All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300012469|Ga0150984_123442815All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium789Open in IMG/M
3300012924|Ga0137413_11451493All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012955|Ga0164298_10918639All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012955|Ga0164298_11502170All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012957|Ga0164303_11024320All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012976|Ga0134076_10119280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1060Open in IMG/M
3300012984|Ga0164309_10106776All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300012984|Ga0164309_10845334All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300012985|Ga0164308_11572867All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300013296|Ga0157374_12789687All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium516Open in IMG/M
3300013764|Ga0120111_1139486All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300014154|Ga0134075_10534334All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300014166|Ga0134079_10542388All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300015245|Ga0137409_10189309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1860Open in IMG/M
3300015373|Ga0132257_100374543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1726Open in IMG/M
3300018431|Ga0066655_10323016All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300020001|Ga0193731_1160562All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium546Open in IMG/M
3300022532|Ga0242655_10233905All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300025906|Ga0207699_11104807All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium587Open in IMG/M
3300025929|Ga0207664_10748217All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium879Open in IMG/M
3300026023|Ga0207677_12056735All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium531Open in IMG/M
3300026308|Ga0209265_1240552All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium502Open in IMG/M
3300026322|Ga0209687_1279551All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium524Open in IMG/M
3300026548|Ga0209161_10320584All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium721Open in IMG/M
3300028592|Ga0247822_11685702All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300028720|Ga0307317_10324480All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium520Open in IMG/M
3300030990|Ga0308178_1004628All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300030993|Ga0308190_1005353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1658Open in IMG/M
3300031058|Ga0308189_10016728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1652Open in IMG/M
3300031091|Ga0308201_10050844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1038Open in IMG/M
3300031231|Ga0170824_105029219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1134Open in IMG/M
3300031239|Ga0265328_10319592All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium601Open in IMG/M
3300031421|Ga0308194_10014455All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300031421|Ga0308194_10123385All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium772Open in IMG/M
3300031474|Ga0170818_109209484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1193Open in IMG/M
3300031996|Ga0308176_10317936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1524Open in IMG/M
3300032954|Ga0335083_10218811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → environmental samples → uncultured Armatimonadetes bacterium1727Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil22.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.73%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.98%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010095Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010096Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010103Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010108Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010115Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010121Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010229Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1EngineeredOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P1_C_008730702140918006SoilLIGAIFLVIVLVSPGGLIGLWERVLNLFSGRSRGPLDRTPVEL
deeps_018436102199352024SoilVVVSPGGLVGLWERLVNLFSGTRRDPLELGPAEPSV
C688J35102_11770956223300002568SoilGAIFLVIVLVSPGGLVGLWERVVNLIFGRRRGPTDPNPIDVGQVEPSV*
Ga0062595_10170081023300004479SoilLIGAIFLVIVLVSPGGLIELWERVLNLFSGSRRGPLDRAPVELGHAEPTV*
Ga0066678_1037742623300005181SoilRFHTLIGAIFLAIVLVSPSGMIGLWERALSLFSGRRRGPLDRTPIEVGPAEPSV*
Ga0070659_10198877223300005366Corn RhizosphereVSPGGLVGLWERVIELTFGRRRGPTDPNPIDVGQVEPSV*
Ga0070694_10176831213300005444Corn, Switchgrass And Miscanthus RhizosphereVSPGGLLGLWERVVSLRSGRRRGPRDRDPIDVGQAEPSV*
Ga0066689_1073665013300005447SoilAIFLVIVLVSPGGLVGLWERVVDLAFGQRRGPTDPNPIDVGQVEPSV*
Ga0066681_1080031223300005451SoilFLVIVLVSPGGLVGLWERVVDLAFGQRRGPTDPNPIDVGQVEPSV*
Ga0070681_1098938613300005458Corn RhizosphereIGAIFLVIVLVSPGGLVGLWERVVNLFSGRRRGPLDRTPVGLGQAEPSV*
Ga0070706_10206264813300005467Corn, Switchgrass And Miscanthus RhizosphereFHTLIGAIFLVIVLLSPSGMIGLWERALSLFSGRRRGPLDRTPIEVGPAEPSV*
Ga0070707_10046843213300005468Corn, Switchgrass And Miscanthus RhizosphereHTLIGAIFLVIVLVSPGGLLGLWERALSLFSGRSPGPRDRDRIDVGQAEPSV*
Ga0075283_109176623300005891Rice Paddy SoilVSPGGLVGLWDRIVALSFWRRRGPTNRNPIEAGQVEPSV*
Ga0066652_10154900523300006046SoilIGAIFLLIVLVSPGGLIGLWERALTLFSGRHRGPRDRNPIEVGHAEPSV*
Ga0097621_10174014313300006237Miscanthus RhizosphereTLIGLIFLALVLVSPGGLIGLWERAVTKFSGRRRGPTNPSPTVGQAEPTT*
Ga0074056_1127335123300006574SoilAIFLVIVLVSPGGLVGLWERAVNFSYGRRRGPSDRNPIEVPQAEPSV*
Ga0074063_1340261623300006953SoilPGGLVGLWERVVAQTFGRRRGPTGRDPVDIGQVEPSV*
Ga0066710_10491789223300009012Grasslands SoilAIFLVIVLVSPGGLVGLWERAVNLFFGRRRGPLDRTPIELRPAEPTV
Ga0066709_10104245923300009137Grasslands SoilGLVFLLIVLVSPSGLIGLWERAVSFLSGPRRGPTDRTPVEVQTPEPSG*
Ga0126309_1003422033300010039Serpentine SoilVSPGGVMGLWERVLALFSGRRRNPHDRNPIEVGQAEPSV*
Ga0127475_110466623300010095Grasslands SoilFHTLIGAIFLVIVLVSPGGLVGLWERVVNLFSGRRRGPLDRMPVELGQAEPTV*
Ga0127473_101703613300010096Grasslands SoilLIVLVSPGGLIGLWERAVTLFSGRRRGPRDRNPIEVGHAEPSV*
Ga0127500_110771823300010103Grasslands SoilGLVGLWERVVNIFSGRRRGPTDRMPVEFGHAEPTV*
Ga0127474_105059123300010108Grasslands SoilHTLIGAIFLVIVVISPGGLVGLWERLLDLFSGRRRGPLDRSPVELGQAEPTV*
Ga0127495_110303923300010115Grasslands SoilLIGAIFLLIVLVSPGGLIGLWERALTLFSGRRRGPRDRNPIEVGHAEPSV*
Ga0127438_108841323300010121Grasslands SoilSPGGLVGLWERVTSLASGGHDDPSDRNPIEVGQVEPGV*
Ga0126320_135603713300010146SoilSPGGLVGLWERLTGASGGRNDPPDRNPIEVGQVEPSV*
Ga0126319_109413523300010147SoilIGAIFLVIVLVSPGGLIGLWERVLSIFSGHRRGPLDRTPVGLGQVEPTV*
Ga0136218_101381723300010229SoilXFHTLIGAIFLVIVVVSPGGLVGLWERLVNLFSGTRRDPLELGPAEPSV*
Ga0134082_1048294113300010303Grasslands SoilIVLVSPSGMIGLWERALSLFSGRRRGPLDRNPIEVGPAEPSV*
Ga0134109_1036743023300010320Grasslands SoilVSPGGLMGLWERALTLLSGRRRDPLDRDRLPIEVGQAEPSV*
Ga0134125_1107207913300010371Terrestrial SoilFLVIVLVSPGGLVGLWERVVNLSYGRRRGPSDRNPIEVGQAEASV*
Ga0134128_1228043523300010373Terrestrial SoilIFLVIVLVSPGGLVGLWERLTGLASGRRNDPSDRNPIEVGQAEPSV*
Ga0134121_1312647713300010401Terrestrial SoilLDTRFQSLIGVIFLVIVLVSPNGLIGAWERLVGLFPGSRRSPLDPVELPVEPSV*
Ga0126349_124678423300010861Boreal Forest SoilFLVLVLVSPGGLIELWERVLNLFSRSRRGPLDRAPVELGHAEPTV*
Ga0137388_1063320923300012189Vadose Zone SoilFHTLIGAIFLVIVLVSPGGLVGLWERVLDLFSGRRRGPLDRTPVGLGQAEPTV*
Ga0150985_10410429323300012212Avena Fatua RhizosphereLIGAIFLVIVLVSPGGLVGLWERVVSISSGRRQGPSDRNPIEVGQIEPSV*
Ga0150985_10483658523300012212Avena Fatua RhizosphereGGLVGLWERVTSLASGRHDDDPSDRNPIEVGQVEPSV*
Ga0150985_10523866923300012212Avena Fatua RhizosphereGLVGLWERVTGLASGRRNDPSDRNPIEVGQVEPSV*
Ga0150985_11244904123300012212Avena Fatua RhizosphereLVSPGGLVGLWEHIQKLFSGRRRGPLDRTPVGLGQAEPSV*
Ga0150985_11320303923300012212Avena Fatua RhizosphereFHTLIGAIFLVIVLVSPGGLVGLWERVVNLIFGRRRGPTDPNPIDVGQVEPSV*
Ga0150985_11812009923300012212Avena Fatua RhizosphereGPRFHTLIGAIFLVIVLVSPGGLVGLWERFLDLFSGRRRGPLNRNPVELGRAEPSV*
Ga0150985_11813402823300012212Avena Fatua RhizosphereHTLIGIVFLVIVLLSPGGLVGLWERVVGQTFGRRRGPTGRNPVDVGQVEPSV*
Ga0150985_11830755413300012212Avena Fatua RhizosphereRFHTLIGAIFLVIVLVSPGGLVGLWERVTELTFGRRRGPTDPNPIDVGQVEPSV*
Ga0150985_11866638013300012212Avena Fatua RhizosphereAIFLVIVLLSPGGLVGLWERFLTLFSGRRRDPLDRLPVEIRHAEPSV*
Ga0150985_12237322623300012212Avena Fatua RhizosphereAIFLVIVLVSPGGVMGLWERALSVFSGRRRTPDDRNPIEVGQAEPSV*
Ga0150985_12288135413300012212Avena Fatua RhizosphereLVSPGGLVGLWERVTSLASGGHDDPSDRNPIEVGQVEPGV*
Ga0137371_1115897123300012356Vadose Zone SoilLIGAIFLVIVLVSPGGLMGLWERALTLLSGRRRDPLDRDRLPIEVGQAEPSV*
Ga0137371_1125396513300012356Vadose Zone SoilPGGLIGLWERAVNLFSGRRRGPLDRTPIELGQAEPSV*
Ga0134058_105949913300012379Grasslands SoilFIGPRFHTLIGVVFLVIVLLSPGGLVGLWERVVEQTFGRRRGPTGRNPVDVGQVEPSV*
Ga0134058_117036723300012379Grasslands SoilVSPGGLIGLWERALTLFSGRHRGPRDRNPIEVGHAEPSV*
Ga0134031_104822523300012388Grasslands SoilGLVGLWERVLNLFSGRRRGPFDRMPVELRPAEPTA*
Ga0134035_111022823300012391Grasslands SoilFHTLIGAIFLVIVLVSPGGLVGLWERVLNLFSGRRRGPFDRMPVELRPAEPTA*
Ga0134056_119069713300012397Grasslands SoilAIFLVIVLVSPGGLIGLWEHVLNLFSGRRRGPLDRNPVELGQAEPSV*
Ga0134051_134375213300012398Grasslands SoilVLVSPGGLMGLWERALTLLSGRRRDPLDRDRLPIEVGQAEPSV*
Ga0134061_110979013300012399Grasslands SoilVLASPGGLVGLWERLVTFVFGRRRGPTDRDRNPIEVGHVEPSV*
Ga0134055_113418023300012401Grasslands SoilFHTLIGAIFLVIVLLSPGGLVGLWERIVTFSSGRRRGPSDRNPIEVGQVEPSI*
Ga0134059_109369913300012402Grasslands SoilAIFLVIVLVSPGGLMGLWERVLNLFSGRRRDPLDRTPIELGQAEPSV*
Ga0134024_130984223300012404Grasslands SoilLIGAIFLVIVLVSPGGLVGLWERVVNLFSGRRRGPLDRMPVELGQAEPTV*
Ga0134053_116921123300012406Grasslands SoilLIGLWERALTLFSGRHRGPRDRNPIEVGNAEPSV*
Ga0134060_122744613300012410Grasslands SoilGLVGLWERVLDLFSGRRRGPFDRTPVELRPAEPTV*
Ga0150984_10384457113300012469Avena Fatua RhizosphereFHTLIGAIFLVIVLLSPGGLVGLWERFLTLFSGRRRDPLDRLPVEIRHAEPSV*
Ga0150984_10411961123300012469Avena Fatua RhizosphereSPGGLVGLWERAVQISSGRRGPTSRTPIEVGPAEPSV*
Ga0150984_10835274723300012469Avena Fatua RhizosphereLLIVLVSPGGLVGLWERLTGASGGRNDPPDRNPIEVGQVEPSV*
Ga0150984_11659629323300012469Avena Fatua RhizosphereLVIVLVSPGGLVGLWERAVTLASRRGNDPDDRTPAAVPQVEPGV*
Ga0150984_12344281523300012469Avena Fatua RhizosphereIGAIFLVIVLVSPGGLVGLWERVVNLIFGRRRGPTDPNPIDVGQVEPSV*
Ga0137413_1145149313300012924Vadose Zone SoilLIGAIFLLIVLVSPGGLVGLWEHVLKLFSGRRRGPPDRNPVGLGQVEPSV*
Ga0164298_1091863913300012955SoilVINNYSQRIGFIGPRFHTLIGAIFLVIVVFSPGGLVGLWERLVNLFSGTRRDPLELGPAEPSV*
Ga0164298_1150217013300012955SoilTLIGAIFLVIVLVSPGGLVGLWERVLTLFSGRRRGPLDRTPVELRPAEPTV*
Ga0164303_1102432023300012957SoilPGGLIELWERVLNLFSVAGVSPLDRAPVELGHAEPTV*
Ga0134076_1011928023300012976Grasslands SoilAIFLVIVLVSPGGLVGLWERVVNLFSGRRRGPLDRMPVELGQAEPTV*
Ga0164309_1010677633300012984SoilGAIFLVIVLVSPGGLVGLWERAVALSSRRRRGPSDRTPIDVGQVEASV*
Ga0164309_1084533423300012984SoilAIFLVIVLVSPGGLIELWERVLNLFSGSRRGPLDRAPVELGHAEPTV*
Ga0164308_1157286723300012985SoilVSPGGLVGLWERVLDLFSGRRRGPLDRTPVELRPAEPTV*
Ga0157374_1278968723300013296Miscanthus RhizosphereIVLVSPGGLVGLWERVVELSFGRRRGPTDPNPIDVGQVEPSV*
Ga0120111_113948623300013764PermafrostVIFLVIVLVSPGGLVGLWERVITFFSGRPPGPRDRSPVEAQRAEPSV*
Ga0134075_1053433423300014154Grasslands SoilLIGAIFLVIVLVSPGGLVGLWERVLDLFSGRRRGPLDRTPVELRPAEPTV*
Ga0134079_1054238813300014166Grasslands SoilGGLVGLWERAVNLFFGRRRGPLDRTPIELRPAEPTA*
Ga0137409_1018930913300015245Vadose Zone SoilLVSPGGLVGLWEHVLNLFSGRRRGPLDRKPIELGQAEPSV*
Ga0132257_10037454313300015373Arabidopsis RhizosphereSPGGLVGLWERVLDLFSGRRRDPLDRAPVEIRHAEPSV*
Ga0066655_1032301623300018431Grasslands SoilFHTLIGAIFLLIVLVSPGGLIGLWERALTLFSGRHRGPRDRNPIEVGHAEPSV
Ga0193731_116056223300020001SoilLVIVLVSPGGLVGLWERAVTFSSGRRRGPSDRTPIEVGRAEPSI
Ga0242655_1023390523300022532SoilVLVSPGGLMGIWERMLNLFSGRRRGPLDRAPIELGQAEPSV
Ga0207699_1110480713300025906Corn, Switchgrass And Miscanthus RhizosphereGGLMGLWERAVTVLFGRRRGPSDRTPIDVGQVEPSV
Ga0207664_1074821723300025929Agricultural SoilSPGGLVGLWERVVAETFGRRRGPTDRNPIDVGQVEPSV
Ga0207677_1205673513300026023Miscanthus RhizosphereSPNGLVGLWERALAEISGRRRGPTDTPTVGQAEPTT
Ga0209265_124055223300026308SoilLVSPSGLIGLWERAVTFFSGPRRGPTDRKPVEVQTAEPSV
Ga0209687_127955123300026322SoilLVSPSGLIGLWERALTFFSGPRRGPTDRKPVDVQTAEPSV
Ga0209161_1032058413300026548SoilIGLVFLLIVLVSPSGLIGLWERALTFFSGPRRGPTDRTPVEVQTAEPSV
Ga0247822_1168570213300028592SoilVGLWERVVSLFSGRRRGPVDQDRNPIEVGQAEPSV
Ga0307317_1032448023300028720SoilPGGLVGLWERVTGLGSGRHDDPSDRNPIEVGQVEPSV
Ga0308178_100462823300030990SoilAIFLVIVVVSPGGLVGLWERLINLFSGRRPGPLDRQPVELGTAEPSV
Ga0308190_100535323300030993SoilGAIFLVIVVVSPGGLVGLWERLINLFSGRRPGPLDRQPVELGTAEPSV
Ga0308189_1001672823300031058SoilVLVSPGGLVGLWERVTGLASGRHHDPSDRNPIEVGQVEPSV
Ga0308201_1005084413300031091SoilGGLVGLWERATGFASGRRNDPSDRNPIEVGQAEPSV
Ga0170824_10502921923300031231Forest SoilGAIFLVIVLVSPGGLMGLWERAVSLTPGRRPGPPNRGSIDLAQAEPTT
Ga0265328_1031959223300031239RhizosphereVLVSPGGLMGLWERTISLTSGRRRGPTDRDSIGLPQAEPTV
Ga0308194_1001445513300031421SoilAIFLVIVVVSPGGLVGLWERLVNLFSGRRPGPLDRQPVELGTAEPSV
Ga0308194_1012338513300031421SoilAIFLVIVLVSPGGLIELWERVLNLFSGSRRGPLDRAPVELGHAEPTV
Ga0170818_10920948423300031474Forest SoilFLVIVLVSPGGLMGLWERAVSLTPGRRPGPPNRGSIDLAQAEPTT
Ga0308176_1031793623300031996SoilAIFLLIVLASPGGLVGLWERATGLMSGRRNDPSDRNPIEVGQAEPSV
Ga0335083_1021881113300032954SoilTLIGAIFLVIILLSPGGLVGLWERIVALASGRREPPGRDPIEVGQVEPSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.