NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101375

Metagenome / Metatranscriptome Family F101375

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101375
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 42 residues
Representative Sequence MCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN
Number of Associated Samples 82
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 19.61 %
% of genes near scaffold ends (potentially truncated) 20.59 %
% of genes from short scaffolds (< 2000 bps) 86.27 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.569 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.314 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01694Rhomboid 1.96
PF00118Cpn60_TCP1 0.98
PF00881Nitroreductase 0.98
PF07998Peptidase_M54 0.98
PF00582Usp 0.98
PF00149Metallophos 0.98
PF04930FUN14 0.98
PF14417MEDS 0.98
PF00578AhpC-TSA 0.98
PF02230Abhydrolase_2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 1.96
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.98
COG1913Predicted Zn-dependent proteaseGeneral function prediction only [R] 0.98
COG2383Uncharacterized membrane protein, Fun14 familyFunction unknown [S] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.00 %
UnclassifiedrootN/A50.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_528029_length_1044_cov_7.358238Not Available1076Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0652187All Organisms → cellular organisms → Archaea1357Open in IMG/M
3300000041|ARcpr5oldR_c010952Not Available774Open in IMG/M
3300000787|JGI11643J11755_11524722All Organisms → cellular organisms → Archaea1393Open in IMG/M
3300000787|JGI11643J11755_11753395All Organisms → Viruses → Predicted Viral2288Open in IMG/M
3300003990|Ga0055455_10284086Not Available528Open in IMG/M
3300004006|Ga0055453_10062397All Organisms → Viruses → Predicted Viral1040Open in IMG/M
3300004114|Ga0062593_102172921Not Available621Open in IMG/M
3300004114|Ga0062593_102569234All Organisms → cellular organisms → Archaea578Open in IMG/M
3300004479|Ga0062595_100100400All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1536Open in IMG/M
3300005045|Ga0071328_149474All Organisms → cellular organisms → Archaea2869Open in IMG/M
3300005045|Ga0071328_163328All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon2466Open in IMG/M
3300005045|Ga0071328_176462All Organisms → cellular organisms → Archaea4701Open in IMG/M
3300005093|Ga0062594_100558230All Organisms → cellular organisms → Archaea989Open in IMG/M
3300005093|Ga0062594_100798580All Organisms → cellular organisms → Archaea872Open in IMG/M
3300005093|Ga0062594_101486104Not Available694Open in IMG/M
3300005093|Ga0062594_101786716Not Available647Open in IMG/M
3300005289|Ga0065704_10265420Not Available955Open in IMG/M
3300005293|Ga0065715_10022016All Organisms → cellular organisms → Archaea2289Open in IMG/M
3300005441|Ga0070700_101157273All Organisms → cellular organisms → Archaea644Open in IMG/M
3300005467|Ga0070706_101518870Not Available612Open in IMG/M
3300005535|Ga0070684_100593873All Organisms → cellular organisms → Archaea1029Open in IMG/M
3300005578|Ga0068854_101852596Not Available554Open in IMG/M
3300005884|Ga0075291_1059070All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon526Open in IMG/M
3300005887|Ga0075292_1074263Not Available515Open in IMG/M
3300005889|Ga0075290_1066323All Organisms → cellular organisms → Archaea515Open in IMG/M
3300006237|Ga0097621_101638951Not Available612Open in IMG/M
3300006845|Ga0075421_100877417Not Available1026Open in IMG/M
3300006847|Ga0075431_100668641Not Available1018Open in IMG/M
3300006853|Ga0075420_101052144Not Available700Open in IMG/M
3300006854|Ga0075425_100009162All Organisms → cellular organisms → Archaea10525Open in IMG/M
3300006903|Ga0075426_10101227All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon2068Open in IMG/M
3300006969|Ga0075419_10741477Not Available699Open in IMG/M
3300009012|Ga0066710_101672418All Organisms → cellular organisms → Archaea970Open in IMG/M
3300009012|Ga0066710_104276700Not Available534Open in IMG/M
3300009146|Ga0105091_10033272Not Available2253Open in IMG/M
3300009176|Ga0105242_11295773Not Available752Open in IMG/M
3300009176|Ga0105242_12720012Not Available545Open in IMG/M
3300009819|Ga0105087_1088836All Organisms → cellular organisms → Archaea562Open in IMG/M
3300010047|Ga0126382_10655505Not Available873Open in IMG/M
3300010371|Ga0134125_10066585All Organisms → cellular organisms → Archaea4010Open in IMG/M
3300010371|Ga0134125_11513859Not Available731Open in IMG/M
3300010371|Ga0134125_12959325Not Available515Open in IMG/M
3300010373|Ga0134128_10634796All Organisms → cellular organisms → Archaea1188Open in IMG/M
3300010375|Ga0105239_12100080All Organisms → cellular organisms → Archaea656Open in IMG/M
3300011003|Ga0138514_100004200All Organisms → cellular organisms → Archaea2051Open in IMG/M
3300011003|Ga0138514_100040419All Organisms → cellular organisms → Archaea915Open in IMG/M
3300011119|Ga0105246_10535953Not Available1001Open in IMG/M
3300012204|Ga0137374_10051223All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4249Open in IMG/M
3300012355|Ga0137369_10324428All Organisms → cellular organisms → Archaea1133Open in IMG/M
3300012668|Ga0157216_10352576Not Available662Open in IMG/M
3300012684|Ga0136614_10246502All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1337Open in IMG/M
3300012937|Ga0162653_100011861All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1065Open in IMG/M
3300012941|Ga0162652_100028230All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon827Open in IMG/M
3300012951|Ga0164300_10769397Not Available593Open in IMG/M
3300012951|Ga0164300_10776921Not Available591Open in IMG/M
3300012955|Ga0164298_10619832All Organisms → cellular organisms → Archaea746Open in IMG/M
3300012957|Ga0164303_10497331Not Available780Open in IMG/M
3300012957|Ga0164303_10628140Not Available712Open in IMG/M
3300012957|Ga0164303_10692034Not Available686Open in IMG/M
3300012961|Ga0164302_10182163All Organisms → cellular organisms → Archaea1273Open in IMG/M
3300012984|Ga0164309_11691822All Organisms → cellular organisms → Archaea542Open in IMG/M
3300012984|Ga0164309_11935905Not Available505Open in IMG/M
3300012985|Ga0164308_10881716Not Available787Open in IMG/M
3300012989|Ga0164305_10147712Not Available1590Open in IMG/M
3300012989|Ga0164305_10610328All Organisms → cellular organisms → Archaea878Open in IMG/M
3300013297|Ga0157378_13213924All Organisms → cellular organisms → Archaea508Open in IMG/M
3300015371|Ga0132258_13501319All Organisms → cellular organisms → Archaea1075Open in IMG/M
3300015372|Ga0132256_100161533All Organisms → cellular organisms → Archaea2259Open in IMG/M
3300015373|Ga0132257_100101306All Organisms → cellular organisms → Archaea3315Open in IMG/M
3300015373|Ga0132257_103828886Not Available547Open in IMG/M
3300017997|Ga0184610_1120397Not Available845Open in IMG/M
3300018027|Ga0184605_10371653Not Available644Open in IMG/M
3300018028|Ga0184608_10338931Not Available660Open in IMG/M
3300018056|Ga0184623_10521293Not Available505Open in IMG/M
3300018061|Ga0184619_10146016All Organisms → cellular organisms → Archaea1078Open in IMG/M
3300018071|Ga0184618_10480215Not Available522Open in IMG/M
3300019868|Ga0193720_1028398Not Available797Open in IMG/M
3300019876|Ga0193703_1047580Not Available659Open in IMG/M
3300019879|Ga0193723_1021415All Organisms → cellular organisms → Archaea1980Open in IMG/M
3300019881|Ga0193707_1022253All Organisms → cellular organisms → Archaea2096Open in IMG/M
3300021078|Ga0210381_10043698All Organisms → cellular organisms → Archaea1317Open in IMG/M
3300021078|Ga0210381_10063181All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1139Open in IMG/M
3300021344|Ga0193719_10415217All Organisms → cellular organisms → Archaea552Open in IMG/M
3300022756|Ga0222622_10384465All Organisms → cellular organisms → Archaea985Open in IMG/M
3300025910|Ga0207684_11254827Not Available612Open in IMG/M
3300026121|Ga0207683_10219737Not Available1731Open in IMG/M
3300027577|Ga0209874_1153624All Organisms → cellular organisms → Archaea517Open in IMG/M
3300027787|Ga0209074_10454543Not Available548Open in IMG/M
3300027907|Ga0207428_10926926Not Available614Open in IMG/M
3300030829|Ga0308203_1022707All Organisms → cellular organisms → Archaea827Open in IMG/M
3300030829|Ga0308203_1070528All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon561Open in IMG/M
3300031091|Ga0308201_10064778All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon962Open in IMG/M
3300031092|Ga0308204_10101175All Organisms → cellular organisms → Archaea795Open in IMG/M
3300031226|Ga0307497_10475334Not Available612Open in IMG/M
3300031547|Ga0310887_10478815Not Available746Open in IMG/M
3300031562|Ga0310886_10542743Not Available707Open in IMG/M
3300031847|Ga0310907_10741166Not Available546Open in IMG/M
3300032075|Ga0310890_10634004Not Available831Open in IMG/M
3300032122|Ga0310895_10573249Not Available576Open in IMG/M
3300032179|Ga0310889_10076417Not Available1375Open in IMG/M
3300032211|Ga0310896_10233857All Organisms → cellular organisms → Archaea922Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil3.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.96%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005045Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USAEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005884Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_001035802140918013SoilMCFEFEIPIKRKTKNPNMIDEEFEVEPELEKVQEPVTVSAK
ICChiseqgaiiDRAFT_065218723300000033SoilMCFEFEIPNKAKYKNXNXIVEDREIEPELEKVEEPVTVSAR*
ARcpr5oldR_01095213300000041Arabidopsis RhizosphereMCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSVK*
JGI11643J11755_1152472213300000787SoilMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN*
JGI11643J11755_1175339533300000787SoilMCFEFEIPIKRKTKNPNMIDEEFEVEPELEKVQEPVTVSAK*
Ga0055455_1028408613300003990Natural And Restored WetlandsMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS*
Ga0055453_1006239713300004006Natural And Restored WetlandsMCFEFEIPNKKKDKNLNTIDEELEVEPELKKVQEPITVSIN*
Ga0062593_10217292123300004114SoilMCFEFEIPNKKKDKNLHTIDEELEVEPELGKAQEPVTVSAK*
Ga0062593_10256923423300004114SoilYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS*
Ga0062595_10010040023300004479SoilMCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITITAN*
Ga0071328_14947433300005045PermafrostMQYYTMCFEFEIPNKKKDKKINTIDEELEVEPELEKVEEPVKVSVN*
Ga0071328_16332823300005045PermafrostMCFEFEIPSKKKYKNLNMIDEELEFEPELEKVQEPVTGSVN*
Ga0071328_17646233300005045PermafrostMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVVEPVTVSAS*
Ga0062594_10055823023300005093SoilMCFELEIPNKKKDKNGNMIDEEFEVEPELGKVQEPVTVPAN*
Ga0062594_10079858013300005093SoilMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS*
Ga0062594_10148610413300005093SoilMCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAN*
Ga0062594_10178671623300005093SoilMCFEFEIPIRKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK*
Ga0065704_1026542013300005289Switchgrass RhizosphereLYFECTKDIMCFEFEIPSRIKSKNVNVINEEDVEIEPELEKVEEPVTVSVN*
Ga0065715_1002201623300005293Miscanthus RhizosphereMCFEFEIPNKAKYKNKNEIEDREIEPELEKVEEPVTVSAS*
Ga0070700_10115727333300005441Corn, Switchgrass And Miscanthus RhizosphereMCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK*
Ga0070706_10151887023300005467Corn, Switchgrass And Miscanthus RhizosphereMCFEFEIPYKMRYKNKIRVNEEDLENDPELEKVEEPITITAN*
Ga0070684_10059387313300005535Corn RhizosphereMSFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS*
Ga0068854_10185259623300005578Corn RhizosphereMCFEFEIPNKAKYKNKNEIVEDMEIEPEPEKVEESVIVSAS*
Ga0075291_105907013300005884Rice Paddy SoilIMCFELEIPNKKKDKNLNTIDEELEVEPELEKVQEPVTVLVK*
Ga0075292_107426313300005887Rice Paddy SoilMCFEFEIPNKKKDKSLNTIDEELEVEPELEKVEEPVTVSVN*
Ga0075290_106632323300005889Rice Paddy SoilMVRKISDYIMCFELEIPNKKKDKNLNTIDEELEVEPELEKVQEPVTVLVK*
Ga0097621_10163895113300006237Miscanthus RhizosphereMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS*
Ga0075421_10087741713300006845Populus RhizosphereMKTQYYTMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPVIVSAN*
Ga0075431_10066864123300006847Populus RhizosphereMKTQYYIMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPVIVSAN*
Ga0075420_10105214413300006853Populus RhizosphereMKTQYYIMCFEFEIPSKIRYKNKNEISEDLETEPELEKTEEPVIVSAN*
Ga0075425_100009162133300006854Populus RhizosphereMCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEE
Ga0075426_1010122713300006903Populus RhizosphereMCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITIT
Ga0075419_1074147713300006969Populus RhizosphereMKTQYYIMCFEFEIPSKIRYKNKNEISEDLEIEPELEKTEEPIIVSAN*
Ga0066710_10167241813300009012Grasslands SoilMCFEFEIPYKMKYKNKTRIDEEDLENEPELEKVEEPITISAN
Ga0066710_10427670013300009012Grasslands SoilMCFEFEIPNKVKYKGKKEINEDVVSEPELEKVEEPVTISAK
Ga0105091_1003327233300009146Freshwater SedimentMCFEFEIPSKIRYKNKNEISEDLEIEPELEKAEEPVIVSAN*
Ga0105242_1129577313300009176Miscanthus RhizosphereMCFEFEIPIRKKDKNHNMIDEEFEVEPELEKVQEPVTVSAK*
Ga0105242_1272001213300009176Miscanthus RhizosphereMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVAAS*
Ga0105087_108883623300009819Groundwater SandMCFEFEIPSKIKNKNKNEVSDDVEIEPELEKVEEPVIVSAN*
Ga0126382_1065550513300010047Tropical Forest SoilMCFDFEITSKIRYKNKNEISEELEIEPELEKSERPEPVIVSAN*
Ga0134125_1006658543300010371Terrestrial SoilMCFEFEIPNKAKYKNKNEIVEDREIETELEKVEEPVTVSAS*
Ga0134125_1151385913300010371Terrestrial SoilMCIEFEILNKKKVKNLNNTIDEELEVGPELEKVQEPVTVSVN*
Ga0134125_1295932523300010371Terrestrial SoilMCFEFEIPNKKKDKNLNIIDEDNTEIEPELEKIQEPVTVSVT*
Ga0134128_1063479623300010373Terrestrial SoilMSFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS*
Ga0105239_1210008013300010375Corn RhizosphereFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK*
Ga0138514_10000420023300011003SoilMCFEFEIPNKAKYKNKNEIVEDGEIEPELEKVEEPVTVSAS*
Ga0138514_10004041923300011003SoilMCFEFEIPNKKKDKNLNTIDEEFEVEPELEKVQEQVTVLAN*
Ga0105246_1053595313300011119Miscanthus RhizosphereMCFEFEIPNKAKYKNKNEIVEDREFEPELEKVEEPVTVSAS*
Ga0137374_1005122343300012204Vadose Zone SoilMKHNYQIMCFEYEIPNKMQYKSKNEINEDEDIEPELEKVEETVTISSK*
Ga0137369_1032442823300012355Vadose Zone SoilMCFEYEIPNKMQYKSKNEINEDEDIEPELEKVEETVTISSK*
Ga0157216_1035257623300012668Glacier Forefield SoilMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSVS*
Ga0136614_1024650223300012684Polar Desert SandMKCFEFEIPNKKKDKNLNMNDEELEVEPELEKVQEPVTVSVN*
Ga0162653_10001186133300012937SoilYYTMCIEFEILNKKKDKNLNNTIDEELEVGPEFEKVQEPVTVSVN*
Ga0162652_10002823023300012941SoilNKKKDKNLNNTIDEELEVGPEFEKVQEPVTVSVN*
Ga0164300_1076939723300012951SoilMCLEFEIPNKAKYKNKNEIVEDIEIEPELEKVEEPVTVSAS*
Ga0164300_1077692113300012951SoilMCFEFEIPIKKKDKNLHTIDEELEVEPELEKVQEPVTVSIK*
Ga0164298_1061983223300012955SoilMAIYYLMCFEFEIPITKKDKNLNIIDEELEVEPELEKVQEPVTVSAK*
Ga0164303_1049733123300012957SoilMCLEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN*
Ga0164303_1062814023300012957SoilMCFAFEIPTKRKTKDPNMIDEEFEVEPELEKVQEPVTVSAK*
Ga0164303_1069203423300012957SoilMCFEFEIPNKAKYKNKNEIVEDREIEPELERVEEPVTVSAR*
Ga0164302_1018216323300012961SoilMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHV
Ga0164309_1169182223300012984SoilIYYLMCFEFEIPITKKDKNLNIIDEELEVEPELEKVQEPVTV*
Ga0164309_1193590513300012984SoilMCLEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS*
Ga0164308_1088171613300012985SoilMCFEFEIPNKTKYKNKNEIVEDREIEPELEKVEEPVTVSAN*
Ga0164305_1014771213300012989SoilMCFEFEIPNKAKYKNKNEIEDREIEPELEKVEEPVTVSAN*
Ga0164305_1061032823300012989SoilMCFEFEIPNKKKDKNLHTIDEELEVEPELEKVQEPVTVSI
Ga0157378_1321392423300013297Miscanthus RhizosphereMCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK*
Ga0132258_1350131913300015371Arabidopsis RhizosphereYLMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAN*
Ga0132256_10016153323300015372Arabidopsis RhizosphereMCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSSK*
Ga0132257_10010130623300015373Arabidopsis RhizosphereMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAN*
Ga0132257_10382888623300015373Arabidopsis RhizosphereFEIPSKIRYKNKNEISEEFEIEPELEKAEEPEPVLVSAN*
Ga0184610_112039723300017997Groundwater SedimentMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0184605_1037165323300018027Groundwater SedimentMCIEFEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN
Ga0184608_1033893113300018028Groundwater SedimentMCFEFEIPNKKKDKNLDMIDEDNTEIEPEPERVQEPVTVSVK
Ga0184623_1052129313300018056Groundwater SedimentMCFEFEIPNKAKYKNKNEIVEDMEIEPELEKVEESVTVSAS
Ga0184619_1014601623300018061Groundwater SedimentMCFEFEIPNKKKDKNLNTIEEDLDVEPELEKVQEPVTVSVK
Ga0184618_1048021523300018071Groundwater SedimentMCFEFEIPNKKKDKNLNTIDEEFEVEPELEKVQEPVTVSAN
Ga0193720_102839823300019868SoilMCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAN
Ga0193703_104758013300019876SoilLNVYYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0193723_102141513300019879SoilYYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0193707_102225333300019881SoilMCFEFEIPNKKKGKNLNTIEEDLDIEPELEKVQEPVTVSVK
Ga0210381_1004369833300021078Groundwater SedimentMCFEFEIPNKAKYKNKNEIVEDRENEPELEKVEEPVTVSAS
Ga0210381_1006318113300021078Groundwater SedimentMCFEFEIPNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN
Ga0193719_1041521723300021344SoilYFIMCFEFEIPNKKKGKNLNTIEEDLDIEPELEKVQEPVTVSVK
Ga0222622_1038446523300022756Groundwater SedimentIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0207684_1125482723300025910Corn, Switchgrass And Miscanthus RhizosphereMCFEFEIPYKMRYKNKIRVNEEDLENDPELEKVEEPITITAN
Ga0207683_1021973733300026121Miscanthus RhizosphereMCFEFEIPNKKKDKNVNMIDEEFEVEPELEKVQEPVTVSAK
Ga0209874_115362423300027577Groundwater SandMCFEFEIPSKIKNKNKNEVSDDVEIEPELEKVEEPVIVSAN
Ga0209074_1045454313300027787Agricultural SoilMCFEFEIPYKMRYKNKIRVDEEDLENDPELEKVEEPITITAN
Ga0207428_1092692623300027907Populus RhizosphereMCFEFEIPNKKKDKNLNMIDEEFEVEPELEKVQEPVTVSVK
Ga0308203_102270713300030829SoilEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0308203_107052823300030829SoilFEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN
Ga0308201_1006477813300031091SoilEFEILNKKKDKNLNNTIDEELEVGPELEKVQEPVTVSVN
Ga0308204_1010117513300031092SoilNVYYYLMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAS
Ga0307497_1047533413300031226SoilMCFEFEIPNKAKYKNKNEIVEDREIEPELEKVEEPVTVSAN
Ga0310887_1047881533300031547SoilMCFEFEIPNKKKDKNLHTMDEEFEVEPELEKVQEPVTVSAK
Ga0310886_1054274313300031562SoilMCFEFEIPNKARSKNKNEIVEDTETAPELEKLEEHVTVSAS
Ga0310907_1074116623300031847SoilMCFEFEIPNKAKYKNKNEIVEDMEIEPEPEKVEESVIVSAS
Ga0310890_1063400423300032075SoilMCFEFEIPIRKKDKNHNMIDEEFEVEPELEKVQEPVTVSAK
Ga0310895_1057324913300032122SoilMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSAS
Ga0310889_1007641723300032179SoilMCFEFEIPNKAKSKNKNEIVEDTETAPELEKLEEHVTVSTS
Ga0310896_1023385723300032211SoilMCFEFEIPIRKKDKNLNMIDEEFEVEPELEKVQEPVTVSAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.