Metagenome Family F101470

Basic Information
Family ID	F101470
Family Type	Metagenome
Number of Sequences	102
Average Sequence Length	39 residues
Representative Sequence	DILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Number of Associated Samples	90
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	23.76 %
% of genes near scaffold ends (potentially truncated)	80.39 %
% of genes from short scaffolds (< 2000 bps)	76.47 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Most Common Taxonomy
Group	Bacteria (62.745 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (11.765 % of family members)
Environment Ontology (ENVO)	Unclassified (17.647 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (45.098 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 10.94% β-sheet: 0.00% Coil/Unstructured: 89.06%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF00496	SBP_bac_5	16.67
PF03401	TctC	5.88
PF13575	DUF4135	5.88
PF02353	CMAS	3.92
PF00111	Fer2	1.96
PF04392	ABC_sub_bind	0.98
PF00365	PFK	0.98
PF13472	Lipase_GDSL_2	0.98
PF06100	MCRA	0.98
PF01656	CbiA	0.98
PF00027	cNMP_binding	0.98
PF07015	VirC1	0.98
PF05147	LANC_like	0.98
PF00378	ECH_1	0.98
PF06035	Peptidase_C93	0.98
PF09361	Phasin_2	0.98
PF11941	DUF3459	0.98
PF03713	DUF305	0.98
PF00166	Cpn10	0.98
PF05099	TerB	0.98
PF05128	DUF697	0.98
PF00202	Aminotran_3	0.98
PF01207	Dus	0.98
PF00083	Sugar_tr	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	5.88
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	3.92
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	3.92
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	3.92
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.98
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.98
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.98
COG1192	ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ	Cell cycle control, cell division, chromosome partitioning [D]	0.98
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.98
COG3544	Uncharacterized conserved protein, DUF305 family	Function unknown [S]	0.98
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.98
COG3768	Uncharacterized membrane protein YcjF, UPF0283 family	Function unknown [S]	0.98
COG3793	Tellurite resistance protein TerB	Inorganic ion transport and metabolism [P]	0.98
COG4403	Lantibiotic modifying enzyme	Defense mechanisms [V]	0.98
COG4716	Myosin-crossreactive antigen (function unknown)	Function unknown [S]	0.98

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.75 %
Unclassified	root	N/A	37.25 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.75 %
Unclassified	root	N/A	37.25 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.75 %
Unclassified	root	N/A	37.25 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.27 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	31.37 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	19.61 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	1.96 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.96 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.96 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.96 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.98 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.96 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.96 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.98 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.98 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	1.96 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.96 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	0.98 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.98 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.25 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.96 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.96 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.98 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	0.98 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2040502001\|FACENC_GAMC6GA01B1KFW	Not Available	518	Open in IMG/M
2162886007\|SwRhRL2b_contig_1088114	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300000043\|ARcpr5yngRDRAFT_c003141	All Organisms → cellular organisms → Bacteria	1651	Open in IMG/M
3300000156\|NODE_c0718518	All Organisms → cellular organisms → Bacteria	5565	Open in IMG/M
3300003994\|Ga0055435_10176022	Not Available	607	Open in IMG/M
3300004062\|Ga0055500_10139133	Not Available	568	Open in IMG/M
3300004463\|Ga0063356_103235179	Not Available	702	Open in IMG/M
3300004463\|Ga0063356_105668017	Not Available	536	Open in IMG/M
3300005334\|Ga0068869_100651698	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300005468\|Ga0070707_102084868	Not Available	535	Open in IMG/M
3300005529\|Ga0070741_10001995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	57329	Open in IMG/M
3300005564\|Ga0070664_100865413	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300005607\|Ga0070740_10298616	Not Available	645	Open in IMG/M
3300005618\|Ga0068864_100687984	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300005713\|Ga0066905_100064155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2327	Open in IMG/M
3300006050\|Ga0075028_100750243	Not Available	591	Open in IMG/M
3300006196\|Ga0075422_10001133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	7415	Open in IMG/M
3300006196\|Ga0075422_10073684	Not Available	1274	Open in IMG/M
3300006755\|Ga0079222_10024987	All Organisms → cellular organisms → Bacteria	2464	Open in IMG/M
3300006854\|Ga0075425_101646946	Not Available	722	Open in IMG/M
3300009098\|Ga0105245_10015837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6569	Open in IMG/M
3300009156\|Ga0111538_10346428	Not Available	1880	Open in IMG/M
3300009174\|Ga0105241_10904829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	820	Open in IMG/M
3300010043\|Ga0126380_10054423	Not Available	2182	Open in IMG/M
3300010043\|Ga0126380_10918421	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	729	Open in IMG/M
3300010358\|Ga0126370_10097984	All Organisms → cellular organisms → Bacteria	2020	Open in IMG/M
3300010358\|Ga0126370_10130991	Not Available	1795	Open in IMG/M
3300010358\|Ga0126370_11329262	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	675	Open in IMG/M
3300010358\|Ga0126370_11592461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	625	Open in IMG/M
3300010359\|Ga0126376_10159112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1820	Open in IMG/M
3300010361\|Ga0126378_11560950	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300010371\|Ga0134125_10235957	All Organisms → cellular organisms → Bacteria	2033	Open in IMG/M
3300010371\|Ga0134125_11388544	Not Available	766	Open in IMG/M
3300010373\|Ga0134128_12835377	Not Available	534	Open in IMG/M
3300010376\|Ga0126381_101153394	Not Available	1120	Open in IMG/M
3300010376\|Ga0126381_101780786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	889	Open in IMG/M
3300010376\|Ga0126381_104512284	Not Available	537	Open in IMG/M
3300010396\|Ga0134126_11573618	Not Available	723	Open in IMG/M
3300012487\|Ga0157321_1015438	Not Available	645	Open in IMG/M
3300012501\|Ga0157351_1015801	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300012906\|Ga0157295_10116337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	756	Open in IMG/M
3300012908\|Ga0157286_10044140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1113	Open in IMG/M
3300012913\|Ga0157298_10004189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2066	Open in IMG/M
3300012955\|Ga0164298_11459001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532	Open in IMG/M
3300012971\|Ga0126369_10075596	All Organisms → cellular organisms → Bacteria → Proteobacteria	2970	Open in IMG/M
3300013100\|Ga0157373_10106558	Not Available	1971	Open in IMG/M
3300015245\|Ga0137409_11524223	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300015371\|Ga0132258_13223161	Not Available	1125	Open in IMG/M
3300015372\|Ga0132256_101170424	All Organisms → cellular organisms → Bacteria	883	Open in IMG/M
3300015374\|Ga0132255_100347085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	2149	Open in IMG/M
3300015374\|Ga0132255_103007354	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300017927\|Ga0187824_10111575	All Organisms → cellular organisms → Bacteria → Proteobacteria	886	Open in IMG/M
3300017944\|Ga0187786_10126544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	895	Open in IMG/M
3300017944\|Ga0187786_10319691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	644	Open in IMG/M
3300017959\|Ga0187779_10005360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	7562	Open in IMG/M
3300017961\|Ga0187778_10035130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3065	Open in IMG/M
3300018060\|Ga0187765_10038668	All Organisms → cellular organisms → Bacteria	2400	Open in IMG/M
3300019356\|Ga0173481_10000119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13856	Open in IMG/M
3300021445\|Ga0182009_10340007	Not Available	764	Open in IMG/M
3300022737\|Ga0247747_1001034	Not Available	2841	Open in IMG/M
3300022883\|Ga0247786_1133156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	552	Open in IMG/M
3300023062\|Ga0247791_1046583	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300025321\|Ga0207656_10564186	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300025538\|Ga0210132_1004641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1760	Open in IMG/M
3300025558\|Ga0210139_1077371	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300025878\|Ga0209584_10322087	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300025900\|Ga0207710_10063134	All Organisms → cellular organisms → Bacteria	1685	Open in IMG/M
3300025941\|Ga0207711_10385106	All Organisms → cellular organisms → Bacteria	1301	Open in IMG/M
3300025986\|Ga0207658_10036166	All Organisms → cellular organisms → Bacteria → Proteobacteria	3540	Open in IMG/M
3300026041\|Ga0207639_10509738	Not Available	1100	Open in IMG/M
3300026142\|Ga0207698_10685482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1018	Open in IMG/M
3300026223\|Ga0209840_1075257	Not Available	740	Open in IMG/M
3300026741\|Ga0207510_102747	Not Available	603	Open in IMG/M
3300026960\|Ga0207582_1006584	Not Available	996	Open in IMG/M
3300027403\|Ga0207609_104055	Not Available	544	Open in IMG/M
3300027552\|Ga0209982_1054984	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300027560\|Ga0207981_1022835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1130	Open in IMG/M
3300027706\|Ga0209581_1015269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4361	Open in IMG/M
3300027874\|Ga0209465_10235385	Not Available	915	Open in IMG/M
3300027898\|Ga0209067_10329548	Not Available	844	Open in IMG/M
3300027907\|Ga0207428_10928246	Not Available	614	Open in IMG/M
3300028720\|Ga0307317_10155155	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300028784\|Ga0307282_10469789	Not Available	610	Open in IMG/M
3300028885\|Ga0307304_10624381	Not Available	500	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1000736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5432	Open in IMG/M
3300031170\|Ga0307498_10018295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1553	Open in IMG/M
3300031653\|Ga0315550_1021422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3346	Open in IMG/M
3300031744\|Ga0306918_11035423	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300031896\|Ga0318551_10248725	Not Available	993	Open in IMG/M
3300031913\|Ga0310891_10006558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2539	Open in IMG/M
3300031938\|Ga0308175_101829725	All Organisms → cellular organisms → Bacteria → Proteobacteria	680	Open in IMG/M
3300032003\|Ga0310897_10064956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1360	Open in IMG/M
3300032013\|Ga0310906_10919916	Not Available	625	Open in IMG/M
3300032075\|Ga0310890_10152105	All Organisms → cellular organisms → Bacteria	1531	Open in IMG/M
3300032174\|Ga0307470_10554428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	850	Open in IMG/M
3300032205\|Ga0307472_100075138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2222	Open in IMG/M
3300032205\|Ga0307472_100436445	All Organisms → cellular organisms → Bacteria → Proteobacteria	1108	Open in IMG/M
3300033433\|Ga0326726_11159439	Not Available	751	Open in IMG/M
3300033500\|Ga0326730_1052509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	783	Open in IMG/M
3300033551\|Ga0247830_11661275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	512	Open in IMG/M
3300034090\|Ga0326723_0235711	Not Available	814	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.55%
Host-Associated	Host-Associated	26.47%
Engineered	Engineered	0.98%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.73%
Plants	Host-Associated → Plants	26.47%
Aquatic	Environmental → Aquatic	8.82%
Solid Waste	Engineered → Solid Waste	0.98%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.78%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.75%
Marine	Environmental → Aquatic → Marine	4.90%
Peat	Environmental → Terrestrial → Peat	2.94%
Freshwater	Environmental → Aquatic → Freshwater	1.96%
Sediment	Environmental → Aquatic → Sediment	1.96%
Grass	Engineered → Solid Waste → Grass	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.80%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.90%
Wetlands	Environmental → Aquatic → Marine → Wetlands	3.92%
Loam	Environmental → Terrestrial → Soil → Loam	2.94%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.94%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.96%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.96%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.98%
Sand	Environmental → Terrestrial → Soil → Sand	0.98%
Composting	Engineered → Solid Waste → Grass → Composting	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.86%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.90%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.90%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.90%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.92%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.96%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.98%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.98%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.98%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.98%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.98%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.98%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.88%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.90%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.92%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.94%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.94%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.94%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	2.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.94%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.94%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.98%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.98%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.98%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.98%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.98%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.98%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.98%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.98%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.98%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.98%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.98%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.98%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.98%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.98%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2040502001	Soil microbial communities from sample at FACE Site 2 North Carolina CO2+	Environmental	Open in IMG/M
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Host-Associated	Open in IMG/M
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300003994	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Host-Associated	Open in IMG/M
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300022737	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5	Environmental	Open in IMG/M
3300022883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4	Environmental	Open in IMG/M
3300023062	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025538	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025558	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025878	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026223	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)	Environmental	Open in IMG/M
3300026741	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes)	Environmental	Open in IMG/M
3300026960	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes)	Environmental	Open in IMG/M
3300027403	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes)	Environmental	Open in IMG/M
3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027560	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031150 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031653	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCE_1065030	2040502001	Soil	EDLLTYEVSDEALETVGGKEIAGNYTLGACTGLSVCDG
SwRhRL2b_0537.00001480	2162886007	Switchgrass Rhizosphere	DILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
ARcpr5yngRDRAFT_0031413	3300000043	Arabidopsis Rhizosphere	MTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
NODE_07185186	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0055435_101760221	3300003994	Natural And Restored Wetlands	MTTQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0055500_101391332	3300004062	Natural And Restored Wetlands	DGEVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG*
Ga0063356_1032351791	3300004463	Arabidopsis Thaliana Rhizosphere	MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0063356_1056680171	3300004463	Arabidopsis Thaliana Rhizosphere	MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCP
Ga0068869_1006516981	3300005334	Miscanthus Rhizosphere	MTNEEDIPAFEVSDEALEAAAGSEQVNYTLGACTGLSVCP
Ga0070707_1020848681	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0070741_1000199540	3300005529	Surface Soil	MKTMFEQIEEEILAFDVSDDALEVAAGGKEQASYTLGACTGLSVCPG*
Ga0070664_1008654131	3300005564	Corn Rhizosphere	QEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0070740_102986161	3300005607	Surface Soil	MNETMIAEQEILSFEVSDEALEVTAGSEKEYASYTLGACTGLSVCPQ*
Ga0068864_1006879842	3300005618	Switchgrass Rhizosphere	LAIEVADVALEIAAGTAKEKANFTLGACTGLSECPG*
Ga0066905_1000641552	3300005713	Tropical Forest Soil	MQILGFEVSDEALESAGDSAKKANFTLGACTGLSVCDG*
Ga0075028_1007502431	3300006050	Watersheds	NVTFEVTDEALELAAGAAKEKANFTLGACTGLSVCDG*
Ga0075422_100011338	3300006196	Populus Rhizosphere	VTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0075422_100736841	3300006196	Populus Rhizosphere	HREELVIDTVSDGAEIAAGAAKEQANFTLCTCSGLSVCPG*
Ga0079222_100249875	3300006755	Agricultural Soil	NNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG*
Ga0075425_1016469461	3300006854	Populus Rhizosphere	EILAFEVADVALEIAAGTAGKANFTLGACTGLSECPG*
Ga0105245_100158374	3300009098	Miscanthus Rhizosphere	MTKQEDVLAFEVSDEALEAAAGGEQVNYTLGACTGLSVCPG*
Ga0111538_103464281	3300009156	Populus Rhizosphere	GIVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0105241_109048292	3300009174	Corn Rhizosphere	FKVSDEALEIAAGAAQEKANFTLGACTGLSECPG*
Ga0126380_100544231	3300010043	Tropical Forest Soil	ETLAFNVSDEVLEIAAGSAKEKANFTLGACTGLSECPG*
Ga0126380_109184211	3300010043	Tropical Forest Soil	AFEVSDEALEIAAGTSKEKANFTLGACSGLSVCPG*
Ga0126370_100979844	3300010358	Tropical Forest Soil	LAFNVSDEVLEIAAGTAKEKANFTLGACTGLSECPG*
Ga0126370_101309911	3300010358	Tropical Forest Soil	EELFINLISDEALEIAAGSTKEKANFTLGACSGLSVCPG*
Ga0126370_113292621	3300010358	Tropical Forest Soil	KEILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG*
Ga0126370_115924612	3300010358	Tropical Forest Soil	LIYEVSDEALEIAAGTTREPVNFTLGSCTGLSECPG*
Ga0126376_101591124	3300010359	Tropical Forest Soil	GFEVSDEALESAGDSAKKANFTLGACTGLSVCDG*
Ga0126378_115609502	3300010361	Tropical Forest Soil	DFEIADEALEIASGVANAPANFTLGACTGLSECPG*
Ga0134125_102359572	3300010371	Terrestrial Soil	LPNKEEILAFEVSDEALEAAAGNEQVNYTLGACSGLSVCPG*
Ga0134125_113885441	3300010371	Terrestrial Soil	EVLAFDVSDEALENAAGSETQAFTLGACSGLSVCPG*
Ga0134128_128353771	3300010373	Terrestrial Soil	LAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0126381_1011533941	3300010376	Tropical Forest Soil	KEILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCEG*
Ga0126381_1017807863	3300010376	Tropical Forest Soil	EDEILAFEISDAALETAAGVAKDKANFTLGACTGLSECPG*
Ga0126381_1045122843	3300010376	Tropical Forest Soil	LGFEVSDAALESAAGNAKGKANFTLGACTGLSVCGG*
Ga0134126_115736181	3300010396	Terrestrial Soil	MTNEEDILAFEVSDEALEAAAGNEQVNYTLGACSGLSVCPG*
Ga0157321_10154381	3300012487	Arabidopsis Rhizosphere	EELFINNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG*
Ga0157351_10158012	3300012501	Unplanted Soil	YAMTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0157295_101163371	3300012906	Soil	IFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG*
Ga0157286_100441402	3300012908	Soil	TKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0157298_100041891	3300012913	Soil	ILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0153915_104735361	3300012931	Freshwater Wetlands	MQNTATNLEKAEQLVVAFDVSDEALEMAAGAAKEKANFTLGACSGL
Ga0164298_114590011	3300012955	Soil	DIFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG*
Ga0126369_100755964	3300012971	Tropical Forest Soil	AFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG*
Ga0157373_101065581	3300013100	Corn Rhizosphere	RNYAMTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0137409_115242231	3300015245	Vadose Zone Soil	AFEVSDEALESAAGTAKEKANFTLGACSGLSVCGG*
Ga0132258_132231611	3300015371	Arabidopsis Rhizosphere	QEILAFEVADVALEIAAGTAKGKANFTLGACTGLSECPG*
Ga0132256_1011704242	3300015372	Arabidopsis Rhizosphere	SGISDEALEIAAGTAKEKANFTLGACSGLSVCPG*
Ga0132255_1003470853	3300015374	Arabidopsis Rhizosphere	DGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0132255_1030073542	3300015374	Arabidopsis Rhizosphere	IVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG*
Ga0187824_101115751	3300017927	Freshwater Sediment	LAFDVSDEALEMAAGSAKEKANFTLGACTGLSVCDG
Ga0187786_101265442	3300017944	Tropical Peatland	EILAFEVSDEALESAAGSEKANFTLGACTGLSVCDG
Ga0187786_103196912	3300017944	Tropical Peatland	LISGSSDAALEIAAGIAKEKASFTLGACTGLSVCDG
Ga0187779_100053601	3300017959	Tropical Peatland	ILAFEVADEALEIAGGKEKAGSFTLGACTGLSVCDG
Ga0187778_100351304	3300017961	Tropical Peatland	EILAFEVSDEALEIAAGSEKANFTLGACTGLSVCDG
Ga0187765_100386681	3300018060	Tropical Peatland	EIFGSEVSDAALESAAGTAKDKANFTLGACTGLSVCGG
Ga0173481_100001194	3300019356	Soil	MTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0182009_103400071	3300021445	Soil	MTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0247747_10010342	3300022737	Soil	MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0247786_11331561	3300022883	Soil	DIFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG
Ga0247791_10465831	3300023062	Soil	MTKQEDVLAFEVSDEALEAAAGGEQVNYTLGACTGLSVCPG
Ga0207656_105641861	3300025321	Corn Rhizosphere	KGIVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0210132_10046411	3300025538	Natural And Restored Wetlands	TQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0210139_10773711	3300025558	Natural And Restored Wetlands	MTTQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0209584_103220872	3300025878	Arctic Peat Soil	FEASDEALEAAAGTGREMAANYTLAACSGLSVCPA
Ga0207710_100631343	3300025900	Switchgrass Rhizosphere	MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0207711_103851061	3300025941	Switchgrass Rhizosphere	MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTG
Ga0207658_100361664	3300025986	Switchgrass Rhizosphere	AMTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0207639_105097381	3300026041	Corn Rhizosphere	EQEMLAFEVADEVLEIASGTAKERANFTLGACTGLSECPG
Ga0207698_106854823	3300026142	Corn Rhizosphere	NILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0209840_10752572	3300026223	Soil	TLTFEVTDETLEAAAGTVKEKAANYTLAACSGLSVCPA
Ga0207510_1027472	3300026741	Soil	EEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0207582_10065841	3300026960	Soil	TKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0207609_1040551	3300027403	Soil	KQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0209982_10549842	3300027552	Arabidopsis Thaliana Rhizosphere	MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVC
Ga0207981_10228351	3300027560	Soil	GILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0209581_10152692	3300027706	Surface Soil	MKTMFEQIEEEILAFDVSDDALEVAAGGKEQASYTLGACTGLSVCPG
Ga0209465_102353851	3300027874	Tropical Forest Soil	FINLVSDEALEIAAGSTKEKANFTLGACSGLSVCPG
Ga0209067_103295482	3300027898	Watersheds	ILAYDVSDEALEIAAGGKEKAGSYTLGACTGLSVCPG
Ga0207428_109282462	3300027907	Populus Rhizosphere	TMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG
Ga0307317_101551551	3300028720	Soil	EILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG
Ga0307282_104697892	3300028784	Soil	DELFIKLVSDEALEIAAGSVKEKANFTLGACSGLSVCPG
Ga0307304_106243812	3300028885	Soil	AFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG
(restricted) Ga0255311_10007362	3300031150	Sandy Soil	MTNEEDILAFEVSDEALEAAAGSEQLNYTLGACTGLSVCPG
Ga0307498_100182951	3300031170	Soil	AFEVSDEALEIAAGSTKEKANFTLGACSGLSVCPG
Ga0315550_10214221	3300031653	Salt Marsh Sediment	FEVSDEALEAAACMMEDKAANYTLGACSGLSVCPGW
Ga0306918_110354232	3300031744	Soil	LSFDVSDEALEISAGLGKENANFTLGACTGLSECPA
Ga0318551_102487252	3300031896	Soil	LAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCEG
Ga0310891_100065581	3300031913	Soil	ILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG
Ga0308175_1018297252	3300031938	Soil	VMLEKAEEAVLAFEVSDEALEMAAGGALEKANFTLGACSGLSVCDG
Ga0310897_100649561	3300032003	Soil	DSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0310906_109199161	3300032013	Soil	LAFEVADVALEIAAGTAKGKANFTLGACTGLSECPG
Ga0310890_101521051	3300032075	Soil	MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSV
Ga0307470_105544281	3300032174	Hardwood Forest Soil	SILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0307472_1000751381	3300032205	Hardwood Forest Soil	EEELFINNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG
Ga0307472_1004364452	3300032205	Hardwood Forest Soil	EDLFVFEISDDALEAAAGTRNEKAMNFTLGACSGLSECPG
Ga0326726_111594392	3300033433	Peat Soil	DLLIFEISDDVLETAAGTRNEKAVNFTLGACSGLSVCPG
Ga0326730_10525091	3300033500	Peat Soil	ILVFKVSDEALEIAAGSAKDKANFTLGACTGLSECPG
Ga0247830_116612752	3300033551	Soil	IFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG
Ga0326723_0235711_697_813	3300034090	Peat Soil	EVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters