Basic Information | |
---|---|
Family ID | F101551 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 38 residues |
Representative Sequence | MMRYLLRRLGHAFFLLVGVSILAFLFTALAPGNYFDEMRLN |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.47 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.059 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.196 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.118 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 76.47 |
PF08352 | oligo_HPY | 16.67 |
PF14361 | RsbRD_N | 0.98 |
PF00117 | GATase | 0.98 |
PF13432 | TPR_16 | 0.98 |
PF05199 | GMC_oxred_C | 0.98 |
PF13304 | AAA_21 | 0.98 |
PF13619 | KTSC | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.06 % |
Unclassified | root | N/A | 2.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10435401 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300001867|JGI12627J18819_10438087 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005468|Ga0070707_101784731 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005554|Ga0066661_10579643 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005556|Ga0066707_10701396 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005576|Ga0066708_10123904 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
3300005591|Ga0070761_10389474 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300005712|Ga0070764_10403674 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300006031|Ga0066651_10102914 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300006046|Ga0066652_100040563 | All Organisms → cellular organisms → Bacteria | 3428 | Open in IMG/M |
3300006176|Ga0070765_101054599 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300006755|Ga0079222_10323361 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300006903|Ga0075426_10237798 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300007265|Ga0099794_10152495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
3300007265|Ga0099794_10345467 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300009012|Ga0066710_101970238 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300009038|Ga0099829_11431458 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300009088|Ga0099830_11219121 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300009090|Ga0099827_10169711 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
3300010159|Ga0099796_10231560 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010321|Ga0134067_10002575 | All Organisms → cellular organisms → Bacteria | 4493 | Open in IMG/M |
3300010337|Ga0134062_10079519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
3300011269|Ga0137392_10415579 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300011269|Ga0137392_10880386 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300011270|Ga0137391_10100421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2506 | Open in IMG/M |
3300011270|Ga0137391_11388793 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300011270|Ga0137391_11401294 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300011271|Ga0137393_10110155 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
3300011271|Ga0137393_10371210 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300012096|Ga0137389_10096447 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
3300012096|Ga0137389_10168302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1807 | Open in IMG/M |
3300012096|Ga0137389_10322024 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300012189|Ga0137388_10348938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
3300012200|Ga0137382_10617152 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300012202|Ga0137363_10562116 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300012203|Ga0137399_11788281 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012206|Ga0137380_10374602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
3300012208|Ga0137376_11009699 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012362|Ga0137361_10034532 | All Organisms → cellular organisms → Bacteria | 4044 | Open in IMG/M |
3300012362|Ga0137361_10577991 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300012582|Ga0137358_10183380 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300012582|Ga0137358_10459160 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300012683|Ga0137398_10105279 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300012918|Ga0137396_10528052 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300012918|Ga0137396_11137325 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012929|Ga0137404_10108338 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
3300012929|Ga0137404_12039987 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012930|Ga0137407_10180600 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300014157|Ga0134078_10001199 | All Organisms → cellular organisms → Bacteria | 6328 | Open in IMG/M |
3300015241|Ga0137418_10048383 | All Organisms → cellular organisms → Bacteria | 3908 | Open in IMG/M |
3300018431|Ga0066655_10341841 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300018468|Ga0066662_11416203 | Not Available | 720 | Open in IMG/M |
3300020579|Ga0210407_10167018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1701 | Open in IMG/M |
3300020581|Ga0210399_10137723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2013 | Open in IMG/M |
3300021046|Ga0215015_10482693 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300021170|Ga0210400_10112052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2170 | Open in IMG/M |
3300021403|Ga0210397_10042530 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
3300021559|Ga0210409_10930164 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300021559|Ga0210409_11103875 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300024246|Ga0247680_1000861 | All Organisms → cellular organisms → Bacteria | 6994 | Open in IMG/M |
3300024330|Ga0137417_1079549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1609 | Open in IMG/M |
3300026296|Ga0209235_1111914 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300026304|Ga0209240_1228832 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300026331|Ga0209267_1026870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2804 | Open in IMG/M |
3300026482|Ga0257172_1098874 | Not Available | 536 | Open in IMG/M |
3300026496|Ga0257157_1008432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
3300026497|Ga0257164_1032781 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300026507|Ga0257165_1102788 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300026547|Ga0209156_10066369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1861 | Open in IMG/M |
3300026551|Ga0209648_10011650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7649 | Open in IMG/M |
3300026557|Ga0179587_10662580 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300027076|Ga0208860_1017951 | Not Available | 699 | Open in IMG/M |
3300027591|Ga0209733_1099832 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300027643|Ga0209076_1108965 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300027663|Ga0208990_1039229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
3300027671|Ga0209588_1161025 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300027671|Ga0209588_1226824 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300027674|Ga0209118_1218180 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027737|Ga0209038_10162703 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300027768|Ga0209772_10186901 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300027875|Ga0209283_10086066 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300027882|Ga0209590_10104879 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300027903|Ga0209488_10833137 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300028047|Ga0209526_10141719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
3300028146|Ga0247682_1037652 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300028906|Ga0308309_10027419 | All Organisms → cellular organisms → Bacteria | 3855 | Open in IMG/M |
3300030606|Ga0299906_10420172 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300031718|Ga0307474_10997787 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300031718|Ga0307474_11452440 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031720|Ga0307469_10293001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
3300031753|Ga0307477_10565614 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300031754|Ga0307475_10257732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1398 | Open in IMG/M |
3300031754|Ga0307475_10385817 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300031754|Ga0307475_11169616 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031823|Ga0307478_10913451 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300031962|Ga0307479_11194447 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300031962|Ga0307479_11551011 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300032174|Ga0307470_10529031 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300032180|Ga0307471_101673555 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300032180|Ga0307471_102935353 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300032205|Ga0307472_100783888 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300032515|Ga0348332_10523871 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 13.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_104354011 | 3300001593 | Forest Soil | MMRYFLRRLAHACFLLVGVSILTFLFSALAPGNYFDEMRL |
JGI12627J18819_104380872 | 3300001867 | Forest Soil | MRYLFARLIQTVFLLLGVSFLTFLFSSLAPGNYFDEMR |
Ga0070707_1017847311 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLVLRVFHAVLLLMAASVLTFLFTALAPGNYFDETRLNPQISA |
Ga0066661_105796431 | 3300005554 | Soil | MRYLLRRLGHALFLLAGVSILAFLFTALAPGNYFDEMRLNPQ |
Ga0066707_107013961 | 3300005556 | Soil | MRYLLRRLGHALLLLAGVSVLTFLFTALAPGTYFDE |
Ga0066708_101239043 | 3300005576 | Soil | MRYLVRRLGHAFFLLAGASVLAFLFTALAPGTYFDEMRL |
Ga0070761_103894741 | 3300005591 | Soil | MRYFLRRALHAFFLLLGVSLLTFLFSALTPGNYFDEMRLN |
Ga0070764_104036741 | 3300005712 | Soil | MRYFLGRTLHAVFLLFGVSLLTFLFSALTPGNYFDEMRLN |
Ga0066651_101029141 | 3300006031 | Soil | MRYLVRRLGHAFFLLAGASVLAFLFTALAPGTYFDEMR |
Ga0066652_1000405631 | 3300006046 | Soil | MRYLLRRSAHAAFLLLGVSLLAFAFTVLAPGSYFDEMRLNPQIAP |
Ga0070765_1010545992 | 3300006176 | Soil | MRYLLRRTLHAVFLLLGVSLLTFLFSSLTPGNYFD |
Ga0079222_103233611 | 3300006755 | Agricultural Soil | MLYFLRRFGHAVFLLIGVSILAFVFTVLAPGNYFDEM |
Ga0075426_102377981 | 3300006903 | Populus Rhizosphere | MHYLLRRIGHAGFLLAGVSVLAFLFTVLAPGNYFDEMRLN |
Ga0099794_101524953 | 3300007265 | Vadose Zone Soil | MTGFLLRRLRHALFLLIGASILAFLFAALAPGNYF |
Ga0099794_103454671 | 3300007265 | Vadose Zone Soil | MMRYLLRRMGHALFLLAGVSILAFLFTALAPGNYFDE |
Ga0066710_1019702381 | 3300009012 | Grasslands Soil | MRFFFRRLRHACFLLFGVSILAFLFTTLAPGNYFDEM |
Ga0099829_114314581 | 3300009038 | Vadose Zone Soil | MIRYFLRRLAHAFLLVIGVSILAFFFTTLAPGNYFDEMRLNPQ |
Ga0099830_112191211 | 3300009088 | Vadose Zone Soil | MMRYLLRRIAHAFFLLIGVSILAFLFATLAPGNYFDEM |
Ga0099827_101697111 | 3300009090 | Vadose Zone Soil | MMPYLLRRLGHALFLLAGVSILAFFFTALAPGTYFDEM |
Ga0099796_102315602 | 3300010159 | Vadose Zone Soil | MTRFLLRRAGHAVFLLFGVSVLAFVFSTLAPGNYFDEMRLNP |
Ga0134067_100025751 | 3300010321 | Grasslands Soil | MMRYLLRRLSHALFLLAGVSILAFLFAALAPGTYF |
Ga0134062_100795193 | 3300010337 | Grasslands Soil | MMRYLLRRLGHAFFLLVGVSILAFLFTALAPGNYFDEMRLN |
Ga0137392_104155791 | 3300011269 | Vadose Zone Soil | MRYLLQRFLHAALLLAGASVLAFLFTSLAPGNYFD |
Ga0137392_108803862 | 3300011269 | Vadose Zone Soil | MRYLLRRFLHAALLLAGASVLAFLFTSLAPGNYFDEMRLNP |
Ga0137391_101004215 | 3300011270 | Vadose Zone Soil | MRYLLRRLGHALFLLAGVSMLAFLFTSLAPGTYFDEMRLNPQ |
Ga0137391_113887932 | 3300011270 | Vadose Zone Soil | MMPYLLRRMGHALFLLAGVSILAFLFAALAPGNYFDEMRLNP |
Ga0137391_114012942 | 3300011270 | Vadose Zone Soil | MRYFLRRLMQAALLLISVSILTFLFSTFAPGNYFDEMRLNPQ |
Ga0137393_101101553 | 3300011271 | Vadose Zone Soil | MRYLLRRFGHAVFLLVGVSLLAFMFTTLAPGNYFDEMRL |
Ga0137393_103712103 | 3300011271 | Vadose Zone Soil | MRYFLRRLMHAAFLLIGVSILTFLFSTLAPGSYFDEMRL |
Ga0137389_100964471 | 3300012096 | Vadose Zone Soil | VSGASAITRFLLRRLAHAAFLLFGVSVLAFFFSTFAPGNY |
Ga0137389_101683021 | 3300012096 | Vadose Zone Soil | MRYLLRRMLHAVFLLFGVSILTFLFSTLAPGNYFDEMR |
Ga0137389_103220243 | 3300012096 | Vadose Zone Soil | MIRYILRRLGHSFFLLAGVSILAFLFTALAPGNYF |
Ga0137388_103489383 | 3300012189 | Vadose Zone Soil | MRYFLRRLMHAAFLLIGVSILTFLFSTLAPGSYFDEMRLNPQI |
Ga0137382_106171522 | 3300012200 | Vadose Zone Soil | MMRYLLRRLGHAFFLLVGVSILAFLFTALAPGNYFDEMRLNP |
Ga0137363_105621161 | 3300012202 | Vadose Zone Soil | MLIGFLLRRLRHALFLLVGVSVLAFLFAALAPGNYFDEMRLN |
Ga0137399_117882811 | 3300012203 | Vadose Zone Soil | MIRYFLRRLAHAFLLVIGVSILAFFFTTLAPGNYFDEM |
Ga0137380_103746021 | 3300012206 | Vadose Zone Soil | MPYFLRRFVHAVFLLIGVSVLAFGFMVLAPGNYFDEM |
Ga0137376_110096992 | 3300012208 | Vadose Zone Soil | MMRYLLRRLGHAFFLLVGVSILAFLFTALAPGNYF |
Ga0137361_100345321 | 3300012362 | Vadose Zone Soil | MTRFLLRRLAHGAFLLLGVSVLAFLFSTLAPGNYFD |
Ga0137361_105779913 | 3300012362 | Vadose Zone Soil | MRYLARRIVHAVFLLFGVSILAFLFSTLAPGNYFD |
Ga0137358_101833803 | 3300012582 | Vadose Zone Soil | MTRFLLRRAGHAVFLLFGVSVLAFVFSTLAPGSYFDEMRL |
Ga0137358_104591601 | 3300012582 | Vadose Zone Soil | MSYLLRRLLQGVLLLIGASFLTFLFSTLAPGNYLDE |
Ga0137398_101052791 | 3300012683 | Vadose Zone Soil | MRYFLQRFLQAAFLLVGVSLLTFLFSALAPGNYFDEMRL |
Ga0137396_105280522 | 3300012918 | Vadose Zone Soil | MRYFLRRLLQAAFLLIGVSILTFLFSALAPGNYFDEMRL |
Ga0137396_111373252 | 3300012918 | Vadose Zone Soil | MRYFLRRLMQGVFLLIGVSILTFLFSTLAPGNYFDEMRL |
Ga0137404_101083381 | 3300012929 | Vadose Zone Soil | MIRYFLRRLGHSFLLIIGVSILAFFFTTLAPGNYFDEMR |
Ga0137404_120399871 | 3300012929 | Vadose Zone Soil | MRYLLRRLAHALLLIFGVSLLAFLFTTLAPGNYFDEMR |
Ga0137407_101806003 | 3300012930 | Vadose Zone Soil | MRFFLRRLRHACFLLLGVSILAFLFTTLAPGNYFDEMRLNPQI |
Ga0134078_100011997 | 3300014157 | Grasslands Soil | MMRYLVRRLGHAFFLLAGASVLAFLFTALAPGTYFDEMRLNPQIA |
Ga0137418_100483831 | 3300015241 | Vadose Zone Soil | MMRFFLRRLRHAFFLLVGVSILAFLFTSLAPGNYFDEMRLN |
Ga0066655_103418412 | 3300018431 | Grasslands Soil | MRYLLRRFGHAVFLLVGVSLLAFTFTTLAPGNYFDEMR |
Ga0066662_114162032 | 3300018468 | Grasslands Soil | MRYLGRRFLHAVLLLAGVSMVTFLFTSLAPGNYFDEMRL |
Ga0210407_101670183 | 3300020579 | Soil | MRFLLRRLTHAFLLLVGVSILAFLFTALAPGNYFDE |
Ga0210399_101377231 | 3300020581 | Soil | MRYLVRRAAHAALLLASVSVLTFLFTALAPGSYFDDMRLNPQIA |
Ga0215015_104826932 | 3300021046 | Soil | MMRYLLRRLAHAFLHVIGVSILAFLFTTLAPGNYFDEM |
Ga0210400_101120521 | 3300021170 | Soil | MRYFLRRLTHAVFLLIGVSILTFFFSALAPGNYFD |
Ga0210397_100425305 | 3300021403 | Soil | MRYLLRRTLHAVFLLFGVSLLTFLFSALTPGNYFDEMRL |
Ga0210409_109301641 | 3300021559 | Soil | MRFILRRLAHAAFLIFGASILTFLFASLAPGDYFDEMRL |
Ga0210409_111038752 | 3300021559 | Soil | VNYVLRRSGHAVLLLIGVSFLSFLFSSLAPGNYFDEMR |
Ga0247680_10008615 | 3300024246 | Soil | MRYLLRRLLHAFLLVIGVSILAFLFTTLAPGNYFDEMRL |
Ga0137417_10795493 | 3300024330 | Vadose Zone Soil | MTRFLLRRLAHGAFLLLGVSVLAFLFSTLAPGNYF |
Ga0209235_11119143 | 3300026296 | Grasslands Soil | MRYLVRRLGHAFFLLAGASVLAFLFTALAPGTYFDEMRLN |
Ga0209240_12288321 | 3300026304 | Grasslands Soil | MIGFLLRRLRHALFLLIGVSVLAFLFAALAPGNYFDEMRLN |
Ga0209267_10268701 | 3300026331 | Soil | MRYLVRRLGHAFFLLAGASVLAFLFTALAPGTYFDEMRLNPQIA |
Ga0257172_10988741 | 3300026482 | Soil | MTRFLWRRAGHAVFLLFGVSVLAFVFSTLAPGSYFD |
Ga0257157_10084323 | 3300026496 | Soil | MRYFLHRLMQAAFLLIGVSILTFLFSTLAPGNYFVD |
Ga0257164_10327811 | 3300026497 | Soil | MRYLARRFLHAVLLLAGATVVTFLFTALAPGNYFDE |
Ga0257165_11027882 | 3300026507 | Soil | VNYVLRRFVHAILLLIGVSFLSFLFSSLAPGNYFDEMRL |
Ga0209156_100663693 | 3300026547 | Soil | MRYLLRRLSHALFLLAGVSILAFLFAALAPGTYFD |
Ga0209648_100116501 | 3300026551 | Grasslands Soil | MRYILRRLGHAFFLLAGVSILAFLFTALAPGNYFDEMRLNP |
Ga0179587_106625801 | 3300026557 | Vadose Zone Soil | MTRFLLRRAGHAVFLLFGVSILAFVFSALAPGNDFDEMRLNP |
Ga0208860_10179512 | 3300027076 | Forest Soil | MRYFLRRLMQAAFLLVGVSILTFLFSALAPGNYFDDMRLN |
Ga0209733_10998321 | 3300027591 | Forest Soil | MMRYLLRRLGHAVFLLAGVSILAFLFTALAPGDYFDEM |
Ga0209076_11089651 | 3300027643 | Vadose Zone Soil | MRFFFRRLRHACFLLFGVSILAFLFTTLAPGNYFDEMRLN |
Ga0208990_10392293 | 3300027663 | Forest Soil | MIRYFLRRLAHAFLLVIGVSILAFFFTTLAPGNYFDEMR |
Ga0209588_11610252 | 3300027671 | Vadose Zone Soil | MRFLLRRLGHAAFLLVGVSVLAFFFSTLAPGNYFDEMRL |
Ga0209588_12268241 | 3300027671 | Vadose Zone Soil | MRFFLRRLGHAFLLLVGVSILAFLFTTLAPGNYFDEMRLN |
Ga0209118_12181801 | 3300027674 | Forest Soil | MRYFLRRLAHACFLLVGVSILTFLFTALAPGNYFDEMRLN |
Ga0209038_101627031 | 3300027737 | Bog Forest Soil | MRYLLRRTLHAVFLLFGVSLLTFLFSALTPGNYFDEM |
Ga0209772_101869012 | 3300027768 | Bog Forest Soil | MSFLLRRLLQAVFLLIGVSILTFLFSTLAPGNYLDEM |
Ga0209283_100860663 | 3300027875 | Vadose Zone Soil | MSYLLHRLLQAAFLLVGVSILTFLFSALAPGNYFD |
Ga0209590_101048793 | 3300027882 | Vadose Zone Soil | MPYLLRRLGHALFLLAGVSILAFFFTALAPGTYFDEM |
Ga0209488_108331372 | 3300027903 | Vadose Zone Soil | MTGFLLRRVGHAVFLLLGVSVLAFFFSALAPGNYFDEM |
Ga0209526_101417193 | 3300028047 | Forest Soil | MRFFLRRLRHALFLLAGVSILAFLFTTLAPGNYFDEMR |
Ga0247682_10376522 | 3300028146 | Soil | MRYLFRRLLHAFLLVIGVSILAFLFTTLAPGNYFDEM |
Ga0308309_100274196 | 3300028906 | Soil | MRYLLRRTLHAVFLLLGVSLLTFLFSSLTPGNYFDE |
Ga0299906_104201723 | 3300030606 | Soil | LSGRYLLGRLGHALLVLFGVSLLAFLFVELAPGDYFLE |
Ga0307474_109977871 | 3300031718 | Hardwood Forest Soil | MRYFLKRLSHAIFLLLGVSILSFIFTSLAPGNYFD |
Ga0307474_114524402 | 3300031718 | Hardwood Forest Soil | MRFMLCRLAHAAFLMFGASILTFLFASLAPGDYFDEMRLNTQIAPETI |
Ga0307469_102930011 | 3300031720 | Hardwood Forest Soil | MRFMLRRLAHAVFLMFGASILTFLFASLAPGDYFDEMRLNPQ |
Ga0307477_105656141 | 3300031753 | Hardwood Forest Soil | MRYFLRRLMEAAFLLIGVSILTFLFSTLAPGNYFDEMRLN |
Ga0307475_102577323 | 3300031754 | Hardwood Forest Soil | MNYLLRRLSHGVLLLIGVSFLTFLFSTLAPGNYLDEM |
Ga0307475_103858171 | 3300031754 | Hardwood Forest Soil | MRFLLRRFGHALFLLAGVSVLAFLFTSLAPGTYFD |
Ga0307475_111696162 | 3300031754 | Hardwood Forest Soil | MGFILRRLAHAAFLMLGASILTYLFASLAPGDYFDEMR |
Ga0307478_109134511 | 3300031823 | Hardwood Forest Soil | MTRFLLRRAGHAVFLLLGVSVLAFLFSTLAPGNYFDEMRLNP |
Ga0307479_111944471 | 3300031962 | Hardwood Forest Soil | MRYLLRRLGHGLFLLAGVSILAFLFTTLAPGTYFDE |
Ga0307479_115510111 | 3300031962 | Hardwood Forest Soil | VSGARVMTRFLLRRLAHAAFLLFGVSVLAFLFSTFAPGNYFDDMRLDP |
Ga0307470_105290312 | 3300032174 | Hardwood Forest Soil | MIRYFLRRLAHAFLLVIGVSILAFFFTTLAPGNYFDEMRLN |
Ga0307471_1016735551 | 3300032180 | Hardwood Forest Soil | MNYLLRRLTHGALLLIGVSFLTFLFSTLAPGNYLD |
Ga0307471_1029353531 | 3300032180 | Hardwood Forest Soil | MRYLSRRLLQAAFLLFGVSLLTFLFSTLAPGNYLDEMRL |
Ga0307472_1007838881 | 3300032205 | Hardwood Forest Soil | MRYLLRRLLQASFLLFGVSLLTFLFSTLAPGNYLDEM |
Ga0348332_105238711 | 3300032515 | Plant Litter | MRYFLRRALHAVFLLFGVSLLTFLFSALTPGNYFDEMRLNP |
⦗Top⦘ |