Basic Information | |
---|---|
Family ID | F101570 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | MYTSSLELRAWCEQNRNRLYIPEWLLKEWGITVDLNFSAAA |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.92 % |
% of genes near scaffold ends (potentially truncated) | 86.27 % |
% of genes from short scaffolds (< 2000 bps) | 90.20 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.529 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.216 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.196 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 0.00% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF09723 | Zn-ribbon_8 | 5.88 |
PF00903 | Glyoxalase | 2.94 |
PF12728 | HTH_17 | 2.94 |
PF11154 | DUF2934 | 1.96 |
PF12681 | Glyoxalase_2 | 1.96 |
PF00069 | Pkinase | 1.96 |
PF01925 | TauE | 0.98 |
PF13548 | DUF4126 | 0.98 |
PF00535 | Glycos_transf_2 | 0.98 |
PF07238 | PilZ | 0.98 |
PF02371 | Transposase_20 | 0.98 |
PF01740 | STAS | 0.98 |
PF00589 | Phage_integrase | 0.98 |
PF09361 | Phasin_2 | 0.98 |
PF10503 | Esterase_PHB | 0.98 |
PF10711 | DUF2513 | 0.98 |
PF12849 | PBP_like_2 | 0.98 |
PF03352 | Adenine_glyco | 0.98 |
PF14534 | DUF4440 | 0.98 |
PF07676 | PD40 | 0.98 |
PF06723 | MreB_Mbl | 0.98 |
PF12762 | DDE_Tnp_IS1595 | 0.98 |
PF12838 | Fer4_7 | 0.98 |
PF01548 | DEDD_Tnp_IS110 | 0.98 |
PF04116 | FA_hydroxylase | 0.98 |
PF13538 | UvrD_C_2 | 0.98 |
PF07366 | SnoaL | 0.98 |
PF09587 | PGA_cap | 0.98 |
PF01810 | LysE | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.84 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.96 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.98 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.98 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.98 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.53 % |
Unclassified | root | N/A | 26.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10025840 | All Organisms → cellular organisms → Bacteria | 3530 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101620044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300004080|Ga0062385_10654679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300004152|Ga0062386_101209191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300004156|Ga0062589_100584027 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300004477|Ga0068971_1173679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300005171|Ga0066677_10803716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300005176|Ga0066679_10012534 | All Organisms → cellular organisms → Bacteria | 4261 | Open in IMG/M |
3300005178|Ga0066688_10529355 | Not Available | 758 | Open in IMG/M |
3300005187|Ga0066675_10915967 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005435|Ga0070714_101778788 | Not Available | 602 | Open in IMG/M |
3300005450|Ga0066682_10950774 | Not Available | 509 | Open in IMG/M |
3300005537|Ga0070730_10266283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
3300005537|Ga0070730_10335327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300005542|Ga0070732_10006629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6303 | Open in IMG/M |
3300005575|Ga0066702_10565873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
3300005577|Ga0068857_101628307 | Not Available | 630 | Open in IMG/M |
3300005586|Ga0066691_10793857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300006028|Ga0070717_10412310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
3300006034|Ga0066656_10527163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300006052|Ga0075029_100479552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300006059|Ga0075017_100094409 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
3300006086|Ga0075019_10760629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 615 | Open in IMG/M |
3300006176|Ga0070765_100295677 | Not Available | 1495 | Open in IMG/M |
3300006176|Ga0070765_100960387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300006954|Ga0079219_12124430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300009038|Ga0099829_10792521 | Not Available | 787 | Open in IMG/M |
3300009038|Ga0099829_10838094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
3300009038|Ga0099829_11200753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300009038|Ga0099829_11326528 | Not Available | 595 | Open in IMG/M |
3300009088|Ga0099830_10810228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300009088|Ga0099830_11484256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300009089|Ga0099828_10740673 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300009522|Ga0116218_1410451 | Not Available | 604 | Open in IMG/M |
3300010048|Ga0126373_10031435 | All Organisms → cellular organisms → Bacteria | 4596 | Open in IMG/M |
3300010159|Ga0099796_10178334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
3300010379|Ga0136449_100690805 | Not Available | 1714 | Open in IMG/M |
3300010397|Ga0134124_11737961 | Not Available | 657 | Open in IMG/M |
3300011269|Ga0137392_10299199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
3300011269|Ga0137392_11445727 | Not Available | 546 | Open in IMG/M |
3300011270|Ga0137391_10213974 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300011270|Ga0137391_11432403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300011271|Ga0137393_10988417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300012096|Ga0137389_11506080 | Not Available | 569 | Open in IMG/M |
3300012203|Ga0137399_10244928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
3300012206|Ga0137380_10059750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3488 | Open in IMG/M |
3300012206|Ga0137380_11395979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300012210|Ga0137378_10213199 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
3300012210|Ga0137378_10247720 | Not Available | 1658 | Open in IMG/M |
3300012210|Ga0137378_10765202 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300012349|Ga0137387_10537042 | Not Available | 849 | Open in IMG/M |
3300012351|Ga0137386_10837245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300012351|Ga0137386_11256700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300012357|Ga0137384_10458740 | Not Available | 1049 | Open in IMG/M |
3300012357|Ga0137384_11395552 | Not Available | 549 | Open in IMG/M |
3300012363|Ga0137390_10310941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
3300012363|Ga0137390_10318158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1538 | Open in IMG/M |
3300012363|Ga0137390_10438565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
3300012683|Ga0137398_10046575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2549 | Open in IMG/M |
3300012917|Ga0137395_10871158 | Not Available | 652 | Open in IMG/M |
3300012917|Ga0137395_11138966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300012918|Ga0137396_10371496 | Not Available | 1059 | Open in IMG/M |
3300012918|Ga0137396_11123467 | Not Available | 560 | Open in IMG/M |
3300012929|Ga0137404_11637699 | Not Available | 597 | Open in IMG/M |
3300015241|Ga0137418_10584202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300015264|Ga0137403_10006016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13942 | Open in IMG/M |
3300016422|Ga0182039_11724099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300016702|Ga0181511_1394591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300017822|Ga0187802_10013428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2700 | Open in IMG/M |
3300017823|Ga0187818_10340295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300017930|Ga0187825_10039465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1594 | Open in IMG/M |
3300017933|Ga0187801_10041889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1643 | Open in IMG/M |
3300017943|Ga0187819_10795380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300017946|Ga0187879_10504550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300017994|Ga0187822_10194411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300018006|Ga0187804_10119751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
3300018009|Ga0187884_10093785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
3300018012|Ga0187810_10123067 | Not Available | 1030 | Open in IMG/M |
3300018012|Ga0187810_10466508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300025448|Ga0208037_1005148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4424 | Open in IMG/M |
3300025910|Ga0207684_10638713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
3300025922|Ga0207646_10582277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22 | 1005 | Open in IMG/M |
3300025922|Ga0207646_11128854 | Not Available | 689 | Open in IMG/M |
3300025922|Ga0207646_11427692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300025928|Ga0207700_11646985 | Not Available | 567 | Open in IMG/M |
3300026474|Ga0247846_1020684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
3300026551|Ga0209648_10268938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
3300026551|Ga0209648_10368002 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300027439|Ga0209332_1073778 | Not Available | 618 | Open in IMG/M |
3300027497|Ga0208199_1124894 | Not Available | 526 | Open in IMG/M |
3300027857|Ga0209166_10187819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300027862|Ga0209701_10346447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300027875|Ga0209283_10566833 | Not Available | 723 | Open in IMG/M |
3300027875|Ga0209283_10886044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300028047|Ga0209526_10313783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
3300028536|Ga0137415_10927117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300028906|Ga0308309_10787483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300029882|Ga0311368_10433482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 960 | Open in IMG/M |
3300031938|Ga0308175_102088878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300032180|Ga0307471_102762717 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300032205|Ga0307472_102057742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300032828|Ga0335080_12088584 | Not Available | 547 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.90% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100258404 | 3300000567 | Peatlands Soil | VKHLQLTPETYVSSAALRTWCERNKNRIYIPEWLLAEWRLTVDPTFSGAA* |
JGIcombinedJ26739_1016200442 | 3300002245 | Forest Soil | LRTWCEQNRNRCYVPEWLLKEWGFTVDLGFNDAA* |
Ga0062385_106546791 | 3300004080 | Bog Forest Soil | LQLTPEMYTSSPQLRAWCERNRNRCYVPEWLLKAWDITVDPSSAA* |
Ga0062386_1012091912 | 3300004152 | Bog Forest Soil | SQLQLTPEMYTSSAELRAWCERNRNRCYVPEWLLKEWDITVDPSSAA* |
Ga0062589_1005840272 | 3300004156 | Soil | MYISSRELRVWCERNRNRLYVPEWLLKEWGMTVDTTSGLAA* |
Ga0068971_11736791 | 3300004477 | Peatlands Soil | TPEMYAFSQELKLWCERNRNRIYIPEWLLDEWGISVDPNFSDAA* |
Ga0066677_108037162 | 3300005171 | Soil | TSEMYASSVELRIWCEQNRNRIYIPEWLLKEWGITVDLGFNDAA* |
Ga0066679_100125341 | 3300005176 | Soil | LQLTAEMYASSAALRMWCEQNRNRHYVPEWLLEEWDITVDSRL* |
Ga0066688_105293551 | 3300005178 | Soil | MYTSSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0066675_109159671 | 3300005187 | Soil | PEMYTSSVELRIWCEHNTNRIYIPEWLLAEWDITVDLAFGGVA* |
Ga0070714_1017787882 | 3300005435 | Agricultural Soil | VKRLHLKPQMYMSSRELRIWCQQNRNRVFIPEWLLEEWEITVDDLFTGAA* |
Ga0066682_109507741 | 3300005450 | Soil | VRHLQLTPEMYATSIELRTWCEHNRNRCYVPEWLLEEWSITVDPTFSDAA* |
Ga0070730_102662831 | 3300005537 | Surface Soil | AEYVASRELRRWCDRNRNRIYIPEWLLREWGMEVEGIYSGVA* |
Ga0070730_103353271 | 3300005537 | Surface Soil | RQLRLTPQMYAASRELRIWCELNRNRVWVPEWLLQEWGIAVDEVFDRTA* |
Ga0070732_100066292 | 3300005542 | Surface Soil | MYAASRALRLWCEKNRNRVYVPEWLLEEWGIDVDGIFDRTA* |
Ga0066702_105658732 | 3300005575 | Soil | VRQLQLTAGMYTSSRELRAWCERNRNRLYIPEWLLEEWGITVDLNFSVAA* |
Ga0068857_1016283071 | 3300005577 | Corn Rhizosphere | TYASSHELRIWCQQNRNRVYVPEWLLKKWEITVDELFTGAA* |
Ga0066691_107938572 | 3300005586 | Soil | TSSVELRLWCQQNRNRIYIPEWLLKEWDITVDLGFSSVA* |
Ga0070717_104123101 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLQLTVEMYTSSRELRIWCERNRNRVYIPEWLLKDLDIAVDAFFSGVA* |
Ga0066656_105271631 | 3300006034 | Soil | VRHLQLTPEMYATSIELRTWCEHNRNRCYVPEWLLEEWSITVDP |
Ga0075029_1004795521 | 3300006052 | Watersheds | MYSSSFELRSWCEQNRNRLYVPEWLLEEWGITVDPYISAAA* |
Ga0075017_1000944091 | 3300006059 | Watersheds | FELRVRHLQLTPEMYSSSRALRIWCQQNKNRIYIPEWLLKEWHITVDPQFIAAP* |
Ga0075019_107606291 | 3300006086 | Watersheds | GMYTSSAELRIWCERNRNRLYVPEWLLEEWGITVDATFSGVTRPRNNS* |
Ga0070765_1002956774 | 3300006176 | Soil | TADMYISSTALRAWCEQNKNRVYIPELLLAEWRIAVDAA* |
Ga0070765_1009603872 | 3300006176 | Soil | MYASSLELRIWCEQNRNRRYVPESLLAEWRITVDLHFSYAA* |
Ga0079219_121244302 | 3300006954 | Agricultural Soil | ELRCWCEQNRNRCYIPEWLLDAWDIIVDTDFGGAPFPPPGSRLHHS* |
Ga0099829_107925211 | 3300009038 | Vadose Zone Soil | MYTSSRELRAWCEQNRNRLYIPEWLLEEWGITVDQNFFGAVA* |
Ga0099829_108380941 | 3300009038 | Vadose Zone Soil | GTYTSSLELRVWCEQNRNRCYIPEWLLEEWLITVHPNFSAVA* |
Ga0099829_112007531 | 3300009038 | Vadose Zone Soil | RMYTSSLELRAWCEQNRNRCYIPEWLLKEWDITVDANFSAAA* |
Ga0099829_113265281 | 3300009038 | Vadose Zone Soil | MYTSSRELRIWCDRNRNRVYIPEWLLEKWAITVDAIFSGAA* |
Ga0099830_108102283 | 3300009088 | Vadose Zone Soil | EMYASSVELRTWCEQNRNRIDVPEWLLKEWDITVDANFCGAA* |
Ga0099830_114842561 | 3300009088 | Vadose Zone Soil | SLELRAWCEQNRNRCYIPEWLLKEWDISVDANFSAAA* |
Ga0099828_107406733 | 3300009089 | Vadose Zone Soil | YTSSRELRIWCEQNRNRLYIPEWLLKEWGITVDLNFSAAA* |
Ga0116218_14104512 | 3300009522 | Peatlands Soil | MYTSSIELRTWCERNRNRLYIPEWLLKEWGVIVDLGFSGA |
Ga0126373_100314353 | 3300010048 | Tropical Forest Soil | MLVQELELTPEMYAASPELRHWCERNRNRVYIPEWLLKKWDISVDLNFSDAA* |
Ga0099796_101783342 | 3300010159 | Vadose Zone Soil | RLTARMYASSAELRTWCEQNRNRLYVPEWLLEEWSITVDLTSDAAA* |
Ga0136449_1006908055 | 3300010379 | Peatlands Soil | KQLQLTPEMYASSAELWTWCQQNKNRVYIPEWLLVEWRITVDPTFSDAA* |
Ga0134124_117379612 | 3300010397 | Terrestrial Soil | ELTEVMYASSRELRTWCEGNRNRLYVPEWLLAEWDMVVDINFSAAA* |
Ga0137392_102991991 | 3300011269 | Vadose Zone Soil | TPEMYASSVELRTWCEQNRNRIDVPEWLLKEWDITVDANFCGAA* |
Ga0137392_114457272 | 3300011269 | Vadose Zone Soil | HLQLTPEMYASSAELRTWCQQNRNRIYIPEWLLNEWDITVDLGFGSVA* |
Ga0137391_102139743 | 3300011270 | Vadose Zone Soil | MYTSSLELRAWCEQNRNRLYIPEWLLKEWGITVDLNFSAAA* |
Ga0137391_114324031 | 3300011270 | Vadose Zone Soil | ELRAWCQQNRNRIYVPEWLLKEWGITVDLGFNGAA* |
Ga0137393_109884171 | 3300011271 | Vadose Zone Soil | SRELRAWCEQNRNRCYIPEWLLEEWGITVDLNFGAVA* |
Ga0137389_115060801 | 3300012096 | Vadose Zone Soil | MCTSSRELRIWCDRNRNRVYIPEWLLEKLDITVDAIFSG |
Ga0137399_102449282 | 3300012203 | Vadose Zone Soil | AEMYASSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137380_100597501 | 3300012206 | Vadose Zone Soil | MYTSSRELRIWCDRNRNRVYIPEWLLEKWDITVDAIFSGAA* |
Ga0137380_113959792 | 3300012206 | Vadose Zone Soil | ELRIWCEQNRNRIYIPEWLLKEWGITVDLGFNDAA* |
Ga0137378_102131991 | 3300012210 | Vadose Zone Soil | EMYTSSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137378_102477203 | 3300012210 | Vadose Zone Soil | SRELRIWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137378_107652022 | 3300012210 | Vadose Zone Soil | MYTSSRELRIWCDRNRNRVYIPEWLLEKWDITVDAI |
Ga0137387_105370422 | 3300012349 | Vadose Zone Soil | KQLHLTAEMYTSSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137386_108372452 | 3300012351 | Vadose Zone Soil | YASSAQLRIWCEQNRNRLYVPEWLLEEWGMRVDPMFSDAA* |
Ga0137386_112567001 | 3300012351 | Vadose Zone Soil | ELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137384_104587402 | 3300012357 | Vadose Zone Soil | KQLQLTAEMYTSSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137384_113955521 | 3300012357 | Vadose Zone Soil | KQLQLTAEMYTSSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGAA* |
Ga0137390_103109414 | 3300012363 | Vadose Zone Soil | ELRAWCEQNRNRCYVPEWLLKEWGITVDLGFNDAA* |
Ga0137390_103181582 | 3300012363 | Vadose Zone Soil | MYASSVELRTWCEQNRNRIDVPEWLLKEWDITVDANFCGAA* |
Ga0137390_104385653 | 3300012363 | Vadose Zone Soil | RELRAWCEQNRNRVYIPEWLLEEWGITVDPNFSAAA* |
Ga0137398_100465755 | 3300012683 | Vadose Zone Soil | QLTAGMYTSSAELRAWCEQNRNRLYVPEWLLEEWGITVDLNFSTAA* |
Ga0137395_108711581 | 3300012917 | Vadose Zone Soil | LRTWCQQNRNRIYLPEWLLKEWGITVDLGFNDAA* |
Ga0137395_111389662 | 3300012917 | Vadose Zone Soil | SSLELRAWCEQNRNRLYVPEWLLKEWGITVDPTFSAAA* |
Ga0137396_103714964 | 3300012918 | Vadose Zone Soil | LQLTPEMYTSSRELRIWCEQNRNRIYIPEWLLKEWGLTVDLGFNDAA* |
Ga0137396_111234671 | 3300012918 | Vadose Zone Soil | SSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137404_116376992 | 3300012929 | Vadose Zone Soil | MYTSSRELRIWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137418_105842022 | 3300015241 | Vadose Zone Soil | QVKQLQLTAEMYASSRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA* |
Ga0137403_100060163 | 3300015264 | Vadose Zone Soil | MYTSSPELRIWCKRNRNRLYIPEWLLEEWGITVDQNFFGAAA* |
Ga0182039_117240991 | 3300016422 | Soil | GLRTPDYVGSLELKRWCERNRNRVYIPEWLLKEWEMLVDLNFMAA |
Ga0181511_13945912 | 3300016702 | Peatland | VRQLQLTAELYISSRELRAWCEQNRNRRYVPELLLKAWGITVDSSFSDAA |
Ga0187802_100134283 | 3300017822 | Freshwater Sediment | MYISSRELRIWCERNRNRVYIPEWLLQEWDITVDAIFSGAA |
Ga0187818_103402951 | 3300017823 | Freshwater Sediment | ETYTCSRDLRAWCEQNRNRLYVPEWLLEEWGITVDLNFGAVARPNHANNS |
Ga0187825_100394651 | 3300017930 | Freshwater Sediment | LHLAPEKYASSRELRLWCEQNRNRVYVPEWLLAEWGIAVDALPSDAA |
Ga0187801_100418891 | 3300017933 | Freshwater Sediment | LHLTAGMYASSRELRAWCERNKNRCYVPEWLLKEWGITVDINFTAVA |
Ga0187819_107953801 | 3300017943 | Freshwater Sediment | DLRAWCEQNRNRLYVPEWLLEEWGITVDLNFGAVARPNHANNS |
Ga0187879_105045502 | 3300017946 | Peatland | YTSSATLHAWCEQNKNRRYVPEWLLAEWCITVDTYFSDAA |
Ga0187822_101944111 | 3300017994 | Freshwater Sediment | AKRLHLGPEGYASSIELRLWCERNRNRVYVPEWLLQEWGISVDDLSSGAA |
Ga0187804_101197512 | 3300018006 | Freshwater Sediment | SRDLRAWCEQNRNRLYVPEWLLEEWGITVDLNFGAVARPNHANNS |
Ga0187884_100937854 | 3300018009 | Peatland | LYISSRELRAWCEQNRNRRYVPELLLKAWGITVDASFSDAA |
Ga0187810_101230672 | 3300018012 | Freshwater Sediment | AWCEQNRNRLYVPEWLLEEWGITVDLNFGAVARPNHANNS |
Ga0187810_104665081 | 3300018012 | Freshwater Sediment | MYTSSVELRTWCEQNRNRLYVPEWLLEEWGITVELNFTAVA |
Ga0208037_10051485 | 3300025448 | Peatland | RQLQLTAELYISSRELRAWCEQNRNRRYVPELLLKAWGITVDASFSDAA |
Ga0207684_106387133 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTAGMYTSSAELRAWCEQNRNRCYVPEWLLEEWGITVDLNFSAAA |
Ga0207646_105822771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TYSSSLELHAWCEQNRNRLYVPEWLLEEWGITVDLTFGAVA |
Ga0207646_111288541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GMYTSSRELHTWCERNRNRFYIPEWLLEEWGITVDLNFSAAA |
Ga0207646_114276922 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTSSRELRIWCDRNRNRVYIPEWLLEKWDITVDAIFSGAA |
Ga0207700_116469851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLRIWCEQYRNRVDVPEWLLEEWGIRVDPMFSEVA |
Ga0247846_10206844 | 3300026474 | Soil | TYTYSRDLRAWCEQNRNRLYVPEWLLEEWGITVDLNFGAVARPNHANNS |
Ga0209648_102689381 | 3300026551 | Grasslands Soil | MQLTAEMYTSSRELRIWCEQNRNRVYIPEWLLREWDITVDAIFSGAA |
Ga0209648_103680021 | 3300026551 | Grasslands Soil | MYASSVELRAWCEQNRNRIYIPEWLLQEWDITVDLGFNDAARPPPLE |
Ga0209332_10737782 | 3300027439 | Forest Soil | QLTAGMYASSAELRAWCEQNRNRLYVPEWLLEEWGITVDPTFDAAA |
Ga0208199_11248941 | 3300027497 | Peatlands Soil | LRVTQLQLTPEMYASSAELWTWCQQNKNRVYIPEWLLAEWLITVDPTFSDAA |
Ga0209166_101878191 | 3300027857 | Surface Soil | VASRELRRWCDRNRNRIYIPEWLLREWGMEVEGIYSGVA |
Ga0209701_103464472 | 3300027862 | Vadose Zone Soil | AGTYTSSLELRVWCEQNRNRCYVPEWLLEEWLITVDPNFSAVA |
Ga0209283_105668331 | 3300027875 | Vadose Zone Soil | SRELRTWCDRNRNRVYIPEWLLEKWDITVDAIFSGTA |
Ga0209283_108860441 | 3300027875 | Vadose Zone Soil | ELRTWCEQNRNRIDVPEWLLKEWDITVDANFCGAA |
Ga0209526_103137831 | 3300028047 | Forest Soil | APEMYISSVELRIWCEQNRNRIYIPEWLLKEWGITVDLGFNDAA |
Ga0137415_109271172 | 3300028536 | Vadose Zone Soil | TLGMYTSSVELRTWCKRNRNVPEWLLEEWGITVDPYFSGAA |
Ga0308309_107874832 | 3300028906 | Soil | LRLTPEMYASSLELRIWCEQNRNRRYVPESLLAEWRITVDLHFSYAA |
Ga0311368_104334821 | 3300029882 | Palsa | DMYTSSAALRAWCEQNKNRVFIPEWLLKELCIAVDAE |
Ga0308175_1020888781 | 3300031938 | Soil | ELRLWCAQNRNRVYVPEWLLQEWHLTVEPTHSGAV |
Ga0307471_1027627171 | 3300032180 | Hardwood Forest Soil | VPAEFEIQVRELELTPEMYVGSRELKNWCKLNRNRVYIPEWLLRKWDISVDLNFSEAA |
Ga0307472_1020577421 | 3300032205 | Hardwood Forest Soil | SQLRLTARMYASSAELRAWCEENRNRLYVPEWLLEEWGITVDLSFDAAA |
Ga0335080_120885842 | 3300032828 | Soil | LSAALRTWCKLNRNRVYIPEWLLEEWGLEVNVGFSGL |
⦗Top⦘ |