Basic Information | |
---|---|
Family ID | F101696 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 47 residues |
Representative Sequence | VFFNRCASRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 93.14 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.039 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF04820 | Trp_halogenase | 72.55 |
PF12831 | FAD_oxidored | 10.78 |
PF01209 | Ubie_methyltran | 6.86 |
PF00067 | p450 | 2.94 |
PF01979 | Amidohydro_1 | 0.98 |
PF13193 | AMP-binding_C | 0.98 |
PF13450 | NAD_binding_8 | 0.98 |
PF00999 | Na_H_Exchanger | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 6.86 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 6.86 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.94 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.98 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.98 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.98 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.98 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.04 % |
Unclassified | root | N/A | 1.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_103686715 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300004009|Ga0055437_10280403 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005174|Ga0066680_10146543 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
3300005180|Ga0066685_10147557 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300005181|Ga0066678_10731231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 658 | Open in IMG/M |
3300005186|Ga0066676_10485753 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300005332|Ga0066388_100503967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
3300005332|Ga0066388_102814681 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300005332|Ga0066388_103173584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
3300005336|Ga0070680_102006941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300005440|Ga0070705_101782491 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005450|Ga0066682_10669362 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
3300005547|Ga0070693_100432360 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300005547|Ga0070693_101453467 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300005558|Ga0066698_10204945 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300005713|Ga0066905_100355416 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300005713|Ga0066905_101125036 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005713|Ga0066905_101572818 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005764|Ga0066903_100031062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6040 | Open in IMG/M |
3300005764|Ga0066903_105861488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300006173|Ga0070716_101828699 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Victivallales → Victivallaceae → Victivallis → Victivallis vadensis | 503 | Open in IMG/M |
3300006844|Ga0075428_100384579 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300006854|Ga0075425_100297697 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
3300006854|Ga0075425_100841497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1050 | Open in IMG/M |
3300006880|Ga0075429_100944764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
3300006880|Ga0075429_101041373 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300006903|Ga0075426_10783182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
3300007265|Ga0099794_10385152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
3300009094|Ga0111539_11023129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 960 | Open in IMG/M |
3300009094|Ga0111539_11482253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
3300009100|Ga0075418_11710969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
3300009101|Ga0105247_10234947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1246 | Open in IMG/M |
3300009157|Ga0105092_10755271 | Not Available | 568 | Open in IMG/M |
3300009814|Ga0105082_1118002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
3300009816|Ga0105076_1082045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
3300009822|Ga0105066_1142669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300009837|Ga0105058_1060384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 857 | Open in IMG/M |
3300010046|Ga0126384_10452517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1097 | Open in IMG/M |
3300010046|Ga0126384_11996990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
3300010048|Ga0126373_12706992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300010359|Ga0126376_12730778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300010362|Ga0126377_11618735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300010362|Ga0126377_11718489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
3300010398|Ga0126383_10148187 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300010400|Ga0134122_10518530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1083 | Open in IMG/M |
3300011421|Ga0137462_1152376 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012211|Ga0137377_10828444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 858 | Open in IMG/M |
3300012355|Ga0137369_10115051 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
3300012930|Ga0137407_11724653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
3300012976|Ga0134076_10137002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 994 | Open in IMG/M |
3300015245|Ga0137409_10103269 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300015371|Ga0132258_11021320 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2090 | Open in IMG/M |
3300015373|Ga0132257_100902176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1108 | Open in IMG/M |
3300016357|Ga0182032_10336569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1203 | Open in IMG/M |
3300016371|Ga0182034_11494717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
3300016404|Ga0182037_10768631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 829 | Open in IMG/M |
3300016445|Ga0182038_11236794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300018074|Ga0184640_10542610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300018084|Ga0184629_10686601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300020170|Ga0179594_10049009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1420 | Open in IMG/M |
3300021086|Ga0179596_10690760 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300021090|Ga0210377_10102849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Haloferula → unclassified Haloferula → Haloferula sp. BvORR071 | 1907 | Open in IMG/M |
3300025569|Ga0210073_1072410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
3300025885|Ga0207653_10150071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 857 | Open in IMG/M |
3300025885|Ga0207653_10320445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
3300025918|Ga0207662_10481189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 853 | Open in IMG/M |
3300025941|Ga0207711_11660737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
3300025941|Ga0207711_11754113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300026089|Ga0207648_10924174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 816 | Open in IMG/M |
3300026324|Ga0209470_1026064 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
3300026497|Ga0257164_1069336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300026529|Ga0209806_1049607 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300026536|Ga0209058_1152300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1082 | Open in IMG/M |
3300026552|Ga0209577_10173341 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300027384|Ga0209854_1059564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
3300027384|Ga0209854_1081551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300027577|Ga0209874_1064483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
3300027717|Ga0209998_10114753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300031564|Ga0318573_10650949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300031716|Ga0310813_10688092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 912 | Open in IMG/M |
3300031720|Ga0307469_10257275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1410 | Open in IMG/M |
3300031740|Ga0307468_100083800 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300031768|Ga0318509_10630568 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031777|Ga0318543_10201171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 884 | Open in IMG/M |
3300031821|Ga0318567_10163173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
3300031833|Ga0310917_10311745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1065 | Open in IMG/M |
3300031893|Ga0318536_10655201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 524 | Open in IMG/M |
3300031896|Ga0318551_10109716 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300031913|Ga0310891_10171935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
3300031943|Ga0310885_10906874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300032066|Ga0318514_10666448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300032067|Ga0318524_10653859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 554 | Open in IMG/M |
3300032075|Ga0310890_11332938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300032180|Ga0307471_101175926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 932 | Open in IMG/M |
3300032180|Ga0307471_102292487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
3300032180|Ga0307471_103586304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300032180|Ga0307471_103821838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
3300032205|Ga0307472_100571538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 991 | Open in IMG/M |
3300032205|Ga0307472_102324586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300033290|Ga0318519_10835250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
3300034090|Ga0326723_0534687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1036867152 | 3300000955 | Soil | YHVPVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0055437_102804032 | 3300004009 | Natural And Restored Wetlands | PVVPPRPGIGVFFNRCGSRNNLVVSWIEGVVSRDEAARIIEVVRDGMGWAGLP* |
Ga0066680_101465432 | 3300005174 | Soil | HAPAVLPRPGIGVFFNRCAGTNNLVTSWVDGAVTEAEVAQIVEVVRDGMEWTRVP* |
Ga0066685_101475571 | 3300005180 | Soil | VVPPRPGIGVFFNRCGGRNNLVVSWIEGVVTEPESARIIEVIREGMGWSAV* |
Ga0066678_107312312 | 3300005181 | Soil | FNRCRGRNNLVVSWIEGVVTESEAARIIDVVSEGMGWTEAS* |
Ga0066676_104857531 | 3300005186 | Soil | PRPGIGVFFNRCATRSNLVISWIEGAAAEDEVGRIVEVVREGMGWTRIP* |
Ga0066388_1005039673 | 3300005332 | Tropical Forest Soil | PVVPPRPGIGVFFNRCGGRSNVVVSWIEGVVTEVEAARIIEVVREEMGWIDAS* |
Ga0066388_1028146812 | 3300005332 | Tropical Forest Soil | RPGIGVFFNRCGNRNNLVVSWLEGVVSREDAARIIEVVRDGMGWTR* |
Ga0066388_1031735842 | 3300005332 | Tropical Forest Soil | GVFFNRCGGRNNLVVSWIEGVVSDAEATRVMEVVREGMGWSAAS* |
Ga0070680_1020069411 | 3300005336 | Corn Rhizosphere | LGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0070705_1017824911 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR* |
Ga0066689_105535031 | 3300005447 | Soil | VLPRPGIGVFFNRCSTRNNLVISWIDGAAREDDVTRIAEVVREGMGWAEVP* |
Ga0066682_106693622 | 3300005450 | Soil | NRCGSRSNLVVSWIEGVVSEAEVARIIELVRDGMGWTATP* |
Ga0070693_1004323601 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | YHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR* |
Ga0070693_1014534671 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GIGVFFNRCAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPA* |
Ga0066698_102049452 | 3300005558 | Soil | PVVPPRPGIGVFFNRCGGRNNLVVSWIEGVVTDIEAARIVEVIREGMGWSGAN* |
Ga0066905_1003554161 | 3300005713 | Tropical Forest Soil | VPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP* |
Ga0066905_1011250362 | 3300005713 | Tropical Forest Soil | VPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRAGMGWTRTP* |
Ga0066905_1015728181 | 3300005713 | Tropical Forest Soil | YHIPVVPPRPGLGVFFNRCGRRHNVVVSWMAGVASRDEVARIVEVIRDGMGWTRAA* |
Ga0066903_1000310621 | 3300005764 | Tropical Forest Soil | GVFFNRCGSRNNLVVSWIEGAVSDEDVARIIEVVRDGMGWASMS* |
Ga0066903_1058614882 | 3300005764 | Tropical Forest Soil | GLGVFFNRCGSRHNLVVSWLEGVVERDDAARIIEAVRDGMGWTRCASDD* |
Ga0070716_1018286991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HVPVVPPRPGIGVFFNRCAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPA* |
Ga0075428_1003845792 | 3300006844 | Populus Rhizosphere | PVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0075425_1002976971 | 3300006854 | Populus Rhizosphere | GRNNLVVSWIEGVATEGEADTIIETIRREMGWTIAP* |
Ga0075425_1008414972 | 3300006854 | Populus Rhizosphere | RPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0075429_1009447642 | 3300006880 | Populus Rhizosphere | RPGIGVFFNRCAGRWNLVVSFIEGVVSEDEVARVIEIVARGMGWTRAV* |
Ga0075429_1010413731 | 3300006880 | Populus Rhizosphere | VVNGYHAPAVLPRPGVGVFFNRYGATSNLVVSWIDGVVSDDDVAQIVEVVREGMGWAKCA |
Ga0075426_107831822 | 3300006903 | Populus Rhizosphere | CGGRNNLVVSWIEGVVSEAEASRIMEVVREGMGWSAAN* |
Ga0099794_103851522 | 3300007265 | Vadose Zone Soil | VPPRPALGVFFNRCENLDNIVVSWLEGVITDTEAARIIEVIRDGMGWTRTP* |
Ga0111539_110231291 | 3300009094 | Populus Rhizosphere | PVVPPRPGVGVFFNRCGGRNNVVVSWIEGVVNEVEARRIVEVIREGMGWSTAQ* |
Ga0111539_114822531 | 3300009094 | Populus Rhizosphere | DNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0075418_117109691 | 3300009100 | Populus Rhizosphere | PPRPGVGVFFNRCGGRNNVVVSWIEGVVNEVEARRIVEVIREGMGWSTAQ* |
Ga0105247_102349471 | 3300009101 | Switchgrass Rhizosphere | RCGNRNNVVVSWMEGVVSRDEAARIIEVVRDGMGWTRSR* |
Ga0105092_107552712 | 3300009157 | Freshwater Sediment | GIGVFFNRWRSNLVVSWIEGVVSEGEVTGIVEAVTEGMGWSPRL* |
Ga0105082_11180022 | 3300009814 | Groundwater Sand | GIGVFFNRCESRNNLVVSWIEGVVSDAEAARIVEVVRNGMGWTRTP* |
Ga0105076_10820452 | 3300009816 | Groundwater Sand | VFFNRCASRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP* |
Ga0105066_11426691 | 3300009822 | Groundwater Sand | NRCGIRNNLVVSWIEGAVTEDEVRRVVEIVREGMGWTRAR* |
Ga0105058_10603842 | 3300009837 | Groundwater Sand | CESRNNLVVSWIEGVVSDAEAARIIEVIRDGMGWTRTP* |
Ga0126384_104525172 | 3300010046 | Tropical Forest Soil | VVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0126384_119969902 | 3300010046 | Tropical Forest Soil | VVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP* |
Ga0126373_127069922 | 3300010048 | Tropical Forest Soil | ENNLVVSWLEGVVTRQEAERIIEVVRDGMGWRTAA* |
Ga0126376_127307781 | 3300010359 | Tropical Forest Soil | ALGVFLNRCENLDNMVVSWLEGAITDTEAARITEVIRDGMGWTRTP* |
Ga0126377_116187351 | 3300010362 | Tropical Forest Soil | PALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP* |
Ga0126377_117184892 | 3300010362 | Tropical Forest Soil | PGVGVFFNRYGASSNLVVSWIEDVVNDDDVAQIVEVVREGMGWAKRS* |
Ga0126383_101481873 | 3300010398 | Tropical Forest Soil | PRPGIGVFFNRCGGRSNVVVSWIEGVVTEAEAARIIEVVREEMGWSVS* |
Ga0134122_105185301 | 3300010400 | Terrestrial Soil | GVFFNRCAGRNNVVVSWIDGVVSDAEAARIIEVIREGMGWLETDSQV* |
Ga0137462_11523762 | 3300011421 | Soil | FNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR* |
Ga0137377_108284442 | 3300012211 | Vadose Zone Soil | IGVFFNRCGRRNNLVVSWIEGVVSEAEADRILEVIREAMGWSLAP* |
Ga0137369_101150513 | 3300012355 | Vadose Zone Soil | GIGVFFNRCASRNNLVVSWIEGVVSDAEAARIIEVIRDGMEWARTP* |
Ga0137407_117246532 | 3300012930 | Vadose Zone Soil | FNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP* |
Ga0134076_101370022 | 3300012976 | Grasslands Soil | FNRCENLDNIVVSWLEGAITDTEAARIIELIRDGMGWTRTP* |
Ga0137409_101032695 | 3300015245 | Vadose Zone Soil | IGVFFNRCGSRNNLVVSWIEGVVSETEVARIVELVRDGMGWTAAP* |
Ga0132258_110213202 | 3300015371 | Arabidopsis Rhizosphere | CAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPGQAR* |
Ga0132257_1009021762 | 3300015373 | Arabidopsis Rhizosphere | APAVLPRPGVGVFFNRYGATSNLVVSWIDGVVSDDDVAQIVEVVREGMGWAKCA* |
Ga0182032_103365692 | 3300016357 | Soil | NRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS |
Ga0182034_114947171 | 3300016371 | Soil | GIGVFFNRCGDLNNVVVSWIEGVPIETEAQRILEVVREEVGWTVAS |
Ga0182037_107686311 | 3300016404 | Soil | GVFFNRCAGRNNLVVSWIEGVVDDAEATKVIEAIRVGMGWIESERQA |
Ga0182038_112367941 | 3300016445 | Soil | IGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS |
Ga0184640_105426101 | 3300018074 | Groundwater Sediment | ASRNNLVVSWIEGVVSDAEAERIIEVIRDGMRWTRTP |
Ga0184629_106866011 | 3300018084 | Groundwater Sediment | RNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP |
Ga0179594_100490092 | 3300020170 | Vadose Zone Soil | IVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP |
Ga0179596_106907602 | 3300021086 | Vadose Zone Soil | FFNRCESRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP |
Ga0210377_101028493 | 3300021090 | Groundwater Sediment | PGIGVFFNRCSTTNNLVTSWIDGAVSDDEVTRIMEVVSEGMKWTRTPGAAAP |
Ga0210073_10724101 | 3300025569 | Natural And Restored Wetlands | GSRNNLVVSWLDGVVERDDAARIIEVVRDGMGWTPQR |
Ga0207653_101500711 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR |
Ga0207653_103204452 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | GVFFNRCGGRNNLVVSWIEGVVSEAAADRILEVIREAMGWRVAP |
Ga0207662_104811891 | 3300025918 | Switchgrass Rhizosphere | PALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP |
Ga0207711_116607372 | 3300025941 | Switchgrass Rhizosphere | YHIPVVPPRPGLGVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTRSP |
Ga0207711_117541131 | 3300025941 | Switchgrass Rhizosphere | PGIGVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVRDGMGWTRSR |
Ga0207648_109241741 | 3300026089 | Miscanthus Rhizosphere | RPGIGVFFNRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWRVAP |
Ga0209470_10260644 | 3300026324 | Soil | GIGVFFNRCAARNNLVISWVEGAVSEKEVARIIEVVREGMEWVSIP |
Ga0257164_10693362 | 3300026497 | Soil | PVVPPRPGIGVFFNRCGGRNNLVVSWIEGVVSEVEAARIMEVIREGMGWTATC |
Ga0209806_10496073 | 3300026529 | Soil | GIGVFFNRCGGRSNLVVSWIEGVVTEAEAARIVEVIREGMGWSAAN |
Ga0209058_11523001 | 3300026536 | Soil | LPRPGIGVFFNRCAARNNLVISWIEGAVSEKEVARIIEVVREGMEWVSIP |
Ga0209577_101733411 | 3300026552 | Soil | VVPPRPGIGVFFNRCGGRSNLVVSWIEGVVTEAEAARIVEVIREGMGWSAAN |
Ga0209854_10595642 | 3300027384 | Groundwater Sand | CEGRNNLVVSWIEGVVSEAEVARIIEVVREGMGWTAAP |
Ga0209854_10815511 | 3300027384 | Groundwater Sand | VPPRPGIGVFFNRCENRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP |
Ga0209874_10644831 | 3300027577 | Groundwater Sand | VVPPRPGIGVFFNRCESRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP |
Ga0209998_101147531 | 3300027717 | Arabidopsis Thaliana Rhizosphere | RVVNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR |
Ga0318573_106509491 | 3300031564 | Soil | FNRCGPRENVIVSWIEGVLNEVEAARIIEVIREALGWTRTT |
Ga0310813_106880921 | 3300031716 | Soil | NRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWRVAP |
Ga0307469_102572752 | 3300031720 | Hardwood Forest Soil | YHAPAVLPRPGIGVFFNRCATRHNLVVSWIEGAASEGDVAQIVEVVRAGMGWARTA |
Ga0307468_1000838001 | 3300031740 | Hardwood Forest Soil | RCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP |
Ga0318509_106305682 | 3300031768 | Soil | VVPPRPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWIETQRSA |
Ga0318543_102011711 | 3300031777 | Soil | RCGGRSNVVVSWIEGVVTEVEAARIIDVVREEMGWIDAS |
Ga0318567_101631731 | 3300031821 | Soil | GIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA |
Ga0310917_103117452 | 3300031833 | Soil | RPGIGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS |
Ga0318536_106552011 | 3300031893 | Soil | RPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA |
Ga0318551_101097164 | 3300031896 | Soil | NNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA |
Ga0310891_101719352 | 3300031913 | Soil | PRPGVGVFFNRCGGRNNVVVSWIEGVVNEVDARRIVEVIREGMGWSTAQ |
Ga0310885_109068742 | 3300031943 | Soil | GVFFNRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWTVAR |
Ga0318514_106664482 | 3300032066 | Soil | VPVVPPRPGIGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS |
Ga0318524_106538591 | 3300032067 | Soil | FFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMRWTETAWSA |
Ga0310890_113329382 | 3300032075 | Soil | PRPGIGVFFNRCGSRNNLVVSWIEGVATEGEADTIIETIRREMGWTTAP |
Ga0307471_1011759261 | 3300032180 | Hardwood Forest Soil | VFFNRCGNRNNLVVSWLEGVVSREDAARIIEVVRDAMGWSA |
Ga0307471_1022924872 | 3300032180 | Hardwood Forest Soil | PRPALGVFFNRCENLDNIVVSWLEGAITDTEASRIIEVIRDGMGWTRTA |
Ga0307471_1035863041 | 3300032180 | Hardwood Forest Soil | FFNRCWGRSNLVVSWIEGVVTEVEAARIAEVIREGMGWSAAN |
Ga0307471_1038218382 | 3300032180 | Hardwood Forest Soil | VPPRPGIGVFFNRCGSRNNIVVSWIEGVVNEGEAARIIEVVRDALGWMRTP |
Ga0307472_1005715382 | 3300032205 | Hardwood Forest Soil | LDNIVVSWLEGAITDTEAARIIEVIRGGMGWTRTP |
Ga0307472_1023245862 | 3300032205 | Hardwood Forest Soil | GVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR |
Ga0318519_108352502 | 3300033290 | Soil | PVVPPRPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMRWTETAWSA |
Ga0326723_0534687_431_538 | 3300034090 | Peat Soil | GNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR |
⦗Top⦘ |