Basic Information | |
---|---|
Family ID | F101707 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 39 residues |
Representative Sequence | MKHALSEAALPRGFRFAATACGLKKTGALDLAILSSD |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 87.25 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.14 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.647 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.431 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.863 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF14698 | ASL_C2 | 91.18 |
PF00764 | Arginosuc_synth | 3.92 |
PF00206 | Lyase_1 | 0.98 |
PF02355 | SecD_SecF | 0.98 |
PF00696 | AA_kinase | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 3.92 |
COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY02IKXES | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300000891|JGI10214J12806_10810753 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300001593|JGI12635J15846_10124818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101510438 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300002910|JGI25615J43890_1000366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5197 | Open in IMG/M |
3300002914|JGI25617J43924_10029056 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
3300004092|Ga0062389_101657352 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300004152|Ga0062386_100558901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 933 | Open in IMG/M |
3300005447|Ga0066689_10002354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7129 | Open in IMG/M |
3300005468|Ga0070707_100465636 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300005536|Ga0070697_101840233 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005538|Ga0070731_10956860 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005538|Ga0070731_11004314 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005544|Ga0070686_100190011 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300005575|Ga0066702_10566076 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300005586|Ga0066691_10241217 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300005587|Ga0066654_10809015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300005712|Ga0070764_10361941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
3300005713|Ga0066905_100694833 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300006173|Ga0070716_101462872 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300006175|Ga0070712_100342948 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300006175|Ga0070712_101644605 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006806|Ga0079220_10102636 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300006871|Ga0075434_102321837 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300007265|Ga0099794_10249544 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300009038|Ga0099829_10381121 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300009088|Ga0099830_10217261 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300009089|Ga0099828_10218199 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300009137|Ga0066709_100358397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2007 | Open in IMG/M |
3300009629|Ga0116119_1083933 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300009700|Ga0116217_10126172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1727 | Open in IMG/M |
3300010048|Ga0126373_10214570 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300010343|Ga0074044_10417252 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300010359|Ga0126376_10905823 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300010361|Ga0126378_10906587 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300010362|Ga0126377_13116310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300012199|Ga0137383_10589525 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300012202|Ga0137363_10342633 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300012202|Ga0137363_11171930 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012361|Ga0137360_10583366 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300012361|Ga0137360_10608181 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300012362|Ga0137361_11064294 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300012683|Ga0137398_10981731 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012923|Ga0137359_10559291 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300012923|Ga0137359_11735865 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300015053|Ga0137405_1244686 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300015054|Ga0137420_1324600 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300016270|Ga0182036_10907532 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300017822|Ga0187802_10273868 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300018482|Ga0066669_11401742 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300019788|Ga0182028_1498568 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300019887|Ga0193729_1274976 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300019890|Ga0193728_1357659 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300020579|Ga0210407_10465521 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300020579|Ga0210407_10695603 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300020583|Ga0210401_10042032 | All Organisms → cellular organisms → Bacteria | 4327 | Open in IMG/M |
3300021088|Ga0210404_10238826 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300021181|Ga0210388_11233560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 633 | Open in IMG/M |
3300021401|Ga0210393_10187355 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
3300021402|Ga0210385_11326541 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021405|Ga0210387_11439381 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300021432|Ga0210384_10531724 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300021432|Ga0210384_11813526 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300021478|Ga0210402_10485654 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300021560|Ga0126371_13534971 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300024290|Ga0247667_1009148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2024 | Open in IMG/M |
3300025419|Ga0208036_1041572 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300025906|Ga0207699_10214216 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300026835|Ga0207782_104198 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300027014|Ga0207815_1005279 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300027297|Ga0208241_1004305 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300027516|Ga0207761_1085485 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027562|Ga0209735_1025763 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
3300027605|Ga0209329_1106622 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027643|Ga0209076_1086550 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300027655|Ga0209388_1110350 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300027674|Ga0209118_1087368 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300027678|Ga0209011_1189127 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300027698|Ga0209446_1095449 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300027817|Ga0209112_10080458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 1032 | Open in IMG/M |
3300027862|Ga0209701_10318521 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300027884|Ga0209275_10246006 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300027884|Ga0209275_10389896 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300027884|Ga0209275_10926311 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300027905|Ga0209415_10932891 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300028775|Ga0302231_10378219 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300028781|Ga0302223_10218220 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300030043|Ga0302306_10255188 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300030991|Ga0073994_10066141 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300031057|Ga0170834_110581138 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031753|Ga0307477_10550283 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300031770|Ga0318521_10939461 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031771|Ga0318546_10055847 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
3300031823|Ga0307478_10195280 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300031897|Ga0318520_10207567 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300031942|Ga0310916_11311891 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031954|Ga0306926_11055514 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300032064|Ga0318510_10319497 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300032076|Ga0306924_10084647 | All Organisms → cellular organisms → Bacteria | 3561 | Open in IMG/M |
3300032180|Ga0307471_101693106 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300032783|Ga0335079_11108734 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300034163|Ga0370515_0258553 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_09026170 | 2170459010 | Grass Soil | MKYALSEAALPLGFRFSATACGLKKTGALDLALLSSDVPASSA |
JGI10214J12806_108107532 | 3300000891 | Soil | MTQAPPESALPRGFRFAATACGLKKTGALDLALIS |
JGI12635J15846_101248183 | 3300001593 | Forest Soil | MKHALSEASLPHGFRFAATACGLKKTGALDLGLLCSDEPASA |
JGIcombinedJ26739_1015104381 | 3300002245 | Forest Soil | LKHALSEASLPRGFRFAATACGLKKTGALDLAILSSEVP |
JGI25615J43890_10003665 | 3300002910 | Grasslands Soil | MTPPRMQHALSEASLPRGFRFAATACGLKKTGALDFAILSS |
JGI25617J43924_100290563 | 3300002914 | Grasslands Soil | LLKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDVP |
Ga0062389_1016573522 | 3300004092 | Bog Forest Soil | MKHALSEASLPRGFRMAATACGLKKTGALDLALLSSDVPAS |
Ga0062386_1005589011 | 3300004152 | Bog Forest Soil | MKYALSEAALPRGFRFSATACGLKKTGALDLALLSSDVPA |
Ga0066689_100023541 | 3300005447 | Soil | MKQAPSEAALPRGFRFAATACGLKKTGALDLAILSSDVSASAAA |
Ga0070707_1004656362 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LNGVRKVIDMKHALSEAALPRGFRFAATACGLKKTGALDLAILSSD |
Ga0070697_1018402331 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDVLA |
Ga0070731_109568601 | 3300005538 | Surface Soil | MKHAPSEASLPRGFRFAATACGLKKTGALDLAVIT |
Ga0070731_110043141 | 3300005538 | Surface Soil | MKHALSEASLPRGFRFAGLACGLKKTGALDLAIIS |
Ga0070686_1001900112 | 3300005544 | Switchgrass Rhizosphere | MTQAPPESALPKGFRFAATACGLKKTGALDLALISSDVSA |
Ga0066702_105660762 | 3300005575 | Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLAIFSSDVPASA |
Ga0066691_102412172 | 3300005586 | Soil | MKHALSEAALPRGFRFAATACGLKKTGALDLAILSSD |
Ga0066654_108090151 | 3300005587 | Soil | MKQAPSEAALPRGFRFAATACGLKKTGALDLAILSSDVSASAA |
Ga0070764_103619411 | 3300005712 | Soil | MKHALSEASLPRGFRFAGLACGLKKTGALDLAIISSDV |
Ga0066905_1006948331 | 3300005713 | Tropical Forest Soil | MTQAPPESALPKGFRFAAAACGLKKTGALDLALISSDV |
Ga0070716_1014628721 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTQPPTEAALPKGFRFAATACGLKKTGALDLAILSSDV |
Ga0070712_1003429481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVLSEAAVPRGFRFSATACGLKKTGALDLALLSSDVPAS |
Ga0070712_1016446052 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQPPPESALPKGFRFAATACGLKKTGALDLALISSDVPAS |
Ga0079220_101026362 | 3300006806 | Agricultural Soil | MKHALSEAALPLGFRFAATACGLKKTGALDLAILSSDVP |
Ga0075434_1023218371 | 3300006871 | Populus Rhizosphere | MTPAPPESALPKGFRFAATACGLKKTGALDLALISSD |
Ga0099794_102495441 | 3300007265 | Vadose Zone Soil | MQHALSEAALPRGFRFAATACGLKKTGALDLAILSSDVPA |
Ga0099829_103811211 | 3300009038 | Vadose Zone Soil | MTPPAMQHALSEASLPRGFRFAATACGLKKTGALDFAILSSEVPASAA |
Ga0099830_102172611 | 3300009088 | Vadose Zone Soil | MQHALSEAALPRGFRFAATACGLKKTGALDFAILSSD |
Ga0099828_102181992 | 3300009089 | Vadose Zone Soil | MVPPIIQHALSEAALPRGFRFAATACGLKKTGALDFAILCSDVPA |
Ga0066709_1003583971 | 3300009137 | Grasslands Soil | MTQPPPESALPKGFRFAATACGLKKTGALDLALISSDVPA |
Ga0116119_10839332 | 3300009629 | Peatland | MKLALSEAALPRGFRFSATACGLKKTGALDLALLS |
Ga0116217_101261721 | 3300009700 | Peatlands Soil | MKYALSEAALPRGFRFSATACGLKKTGALDLALLSSD |
Ga0126373_102145703 | 3300010048 | Tropical Forest Soil | MKHPPSEAALPHGFRFAATACGLKKTGALDLAIFSSDVPA |
Ga0074044_104172522 | 3300010343 | Bog Forest Soil | LKHALSESSLPRGFRFAATACGLKKTGALDLAILSSEVPASA |
Ga0126376_109058232 | 3300010359 | Tropical Forest Soil | MTPLESALPKGFRFAATACGLKKTGALDLALISSDAP |
Ga0126378_109065871 | 3300010361 | Tropical Forest Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSSDVP |
Ga0126377_131163101 | 3300010362 | Tropical Forest Soil | MTQAPPESALPKGFRFAATACGLKKTGALDLALISSD |
Ga0137383_105895252 | 3300012199 | Vadose Zone Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAVLSSDVTA |
Ga0137363_103426332 | 3300012202 | Vadose Zone Soil | MKQALSEAALPRGFRFAAAACGLKKTGALDLAVFSS |
Ga0137363_111719301 | 3300012202 | Vadose Zone Soil | MKHALSEAALPLGFRFSATACGLKKTGALDLALLSSDVPA |
Ga0137360_105833662 | 3300012361 | Vadose Zone Soil | LIKHALSEASLPRGFRFGATACGLKKTGALDLAVISSDVTA |
Ga0137360_106081811 | 3300012361 | Vadose Zone Soil | MKHALSEAALPLGFRFAATACGLKKTGALDLAVISSDVPASA |
Ga0137361_110642941 | 3300012362 | Vadose Zone Soil | LIKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDV |
Ga0137398_109817312 | 3300012683 | Vadose Zone Soil | MRQSPSESALPREFRFAATACGLKKTGALDLALISSDVPAS |
Ga0137359_105592912 | 3300012923 | Vadose Zone Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAILSS |
Ga0137359_117358651 | 3300012923 | Vadose Zone Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAVLSSDVTASA |
Ga0137405_12446861 | 3300015053 | Vadose Zone Soil | MKHALSESSLPRGFRFAAIACGLKKTGALDLALLSSDL |
Ga0137420_13246002 | 3300015054 | Vadose Zone Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAVFSSDVT |
Ga0182036_109075321 | 3300016270 | Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSSD |
Ga0187802_102738681 | 3300017822 | Freshwater Sediment | MNSVPTEAALPRGFRFAATACGLKKTGALDLALLSSD |
Ga0066669_114017421 | 3300018482 | Grasslands Soil | MTQPPPESALPKGFRFAATACGLKKTGALDLALISS |
Ga0182028_14985681 | 3300019788 | Fen | MKYALSEAALPRGFRFSATACGLKKTGALDLALLS |
Ga0193729_12749761 | 3300019887 | Soil | MKHALSEASLPHGFRFAATACGLKKTGALDLGLLCSDESAS |
Ga0193728_13576592 | 3300019890 | Soil | MKHALSEASLPHGFRFAATACGLKKTGALDLGLLCS |
Ga0210407_104655212 | 3300020579 | Soil | MKHALSEAALPLGFRFSATACGLKKTGALDLALLSSDV |
Ga0210407_106956031 | 3300020579 | Soil | MTPPAMQHALSEASLPRGFRFAATACGLKKTGALDFAI |
Ga0210401_100420325 | 3300020583 | Soil | MKQALSEASLPRGFRFAGIACGLKKTGALDLAMISSD |
Ga0210404_102388261 | 3300021088 | Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDVPASA |
Ga0210388_112335601 | 3300021181 | Soil | VDMKHALSEAALPRGFRFAATACGLKKTGALDLAMFTSEVPASA |
Ga0210393_101873552 | 3300021401 | Soil | LIKQALSEASLPRGFRFAGIACGLKKTGALDLAMISSDV |
Ga0210385_113265411 | 3300021402 | Soil | MKHALSEASLPHGFRFAGLACGLKKTGALDLAIISSD |
Ga0210387_114393811 | 3300021405 | Soil | MKHALSEASLPLGFRFAATACGLKKTGALDLALLSS |
Ga0210384_105317241 | 3300021432 | Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAVISSDVQAS |
Ga0210384_118135262 | 3300021432 | Soil | LIKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDA |
Ga0210402_104856541 | 3300021478 | Soil | MNHALSEASLPRGFRFSATACGLKKTGALDLALLSSD |
Ga0126371_135349712 | 3300021560 | Tropical Forest Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSSDVPA |
Ga0247667_10091483 | 3300024290 | Soil | VTQAPTEAALPKGFRFAATACGLKKTGALDLAILS |
Ga0208036_10415722 | 3300025419 | Peatland | MKLALSEAALPRGFRFSATACGLKKTGALDLALLSSDV |
Ga0207699_102142162 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHALSEASLPRGFRFAAIACGLKKTGALDLAVISSDVSAS |
Ga0207782_1041981 | 3300026835 | Tropical Forest Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSSDLPA |
Ga0207815_10052792 | 3300027014 | Tropical Forest Soil | VDTCIMNHAPSEAALPRGFRFAATACGLKKTGALD |
Ga0208241_10043051 | 3300027297 | Forest Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAIFSSD |
Ga0207761_10854851 | 3300027516 | Tropical Forest Soil | MMKHALTETALPRGFRFSATACGLKKTGALDLALLSSDVLASAAA |
Ga0209735_10257632 | 3300027562 | Forest Soil | MQHALSEAALPRGFRFAATACGLKKTGALDFAILSSDVL |
Ga0209329_11066221 | 3300027605 | Forest Soil | MQHALSEASLPRGFRFAATACGLKKTGALDLAILSSDVLASAAG |
Ga0209076_10865502 | 3300027643 | Vadose Zone Soil | MQHALSEASLPRGFRFAATACGLKKTGALDFAILSSD |
Ga0209388_11103501 | 3300027655 | Vadose Zone Soil | LIKHALSEASLPRGFRFAATACGLKKTGALDLAILSSDM |
Ga0209118_10873681 | 3300027674 | Forest Soil | MNHALSEASLPRGFRFSATACGLKKTGALDLALLSSDVPAS |
Ga0209011_11891272 | 3300027678 | Forest Soil | MQHALSEAALPRGFRFAATACGLKKTGALDLAILSSDAPAS |
Ga0209446_10954491 | 3300027698 | Bog Forest Soil | MNHALSEASLPLGFRFAATACGLKKTGALDLALLSSDVTAS |
Ga0209112_100804581 | 3300027817 | Forest Soil | VDLMHALSEAALPRGFRFAATACGLKKTGALDLAMFTSEVPASA |
Ga0209701_103185211 | 3300027862 | Vadose Zone Soil | MNHALSEASLPRGFRFSATACGLKKTGALDLALLSSDV |
Ga0209275_102460061 | 3300027884 | Soil | MKHALSEAALPRGFRFAATACGLKKTGALDLAMFSS |
Ga0209275_103898961 | 3300027884 | Soil | MKHALSEASLPRGFRFAATACGLKKTGALDLAIFSSEVP |
Ga0209275_109263112 | 3300027884 | Soil | LIKQALSEASLPRGFRFAGIACGLKKTGALDLAMISSD |
Ga0209415_109328911 | 3300027905 | Peatlands Soil | MKQAPSEAALPRGFRFAATACGLKKTGALDLALLSS |
Ga0302231_103782192 | 3300028775 | Palsa | LKHALSESSLPRGFRFAATACGLKKTGALDLAILSSEFPASAAA |
Ga0302223_102182201 | 3300028781 | Palsa | LKHALSESSLPRGFRFAATACGLKKTGALDLAILSS |
Ga0302306_102551881 | 3300030043 | Palsa | LKHALSESSLPRGFRFAATACGLKKTGALDLAILSSEFPAS |
Ga0073994_100661411 | 3300030991 | Soil | LIKHALSEASLPRGFRFAATACGLKKTGALDLAILSSD |
Ga0170834_1105811381 | 3300031057 | Forest Soil | MTQPPPESALPKGFRFAATACGLKKTGALDLALISSD |
Ga0307477_105502831 | 3300031753 | Hardwood Forest Soil | MTPPSMQHALSEASLPRGFRFAATACGLKKTGALDFAILSSEVPA |
Ga0318521_109394612 | 3300031770 | Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSS |
Ga0318546_100558473 | 3300031771 | Soil | MKQAPSEAALPRGFQFAATACGLKKTGALDLAILSS |
Ga0307478_101952801 | 3300031823 | Hardwood Forest Soil | MTTAPPESALPKGFRFAATACGLKKTGALDLALISS |
Ga0318520_102075672 | 3300031897 | Soil | MKQAPSEAALPRGFQFAATACGLKKTGALDLAILSSDVS |
Ga0310916_113118911 | 3300031942 | Soil | MNHAPSEAALPRGFRFAATACGLKRTGALDLALLSSDVPACA |
Ga0306926_110555141 | 3300031954 | Soil | MKPALSEAAVPRGFRFSATACGLKKTGALDLALLSSDVSASAAA |
Ga0318510_103194971 | 3300032064 | Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLT |
Ga0306924_100846474 | 3300032076 | Soil | MNHAPSEAALPRGFRFAATACGLKKTGALDLALLSSDL |
Ga0307471_1016931061 | 3300032180 | Hardwood Forest Soil | MQHALSEASLPRGFRFAATACGLKKTGALDFAILS |
Ga0335079_111087341 | 3300032783 | Soil | MNSVPTEAALPRGFRFAATACGLKKTGALDLALLSSDVPA |
Ga0370515_0258553_622_738 | 3300034163 | Untreated Peat Soil | MKHALSEAALPRGFRFAATACGLKKTGALDLAIFSSDVP |
⦗Top⦘ |