Basic Information | |
---|---|
Family ID | F101871 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | YDSLLFDFSKEDGKDTLEELQNILESGKKYPVKFKYSKDLCL |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.98 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 91.18 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (91.176 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.961 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.176 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 8.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00154 | RecA | 2.94 |
PF02739 | 5_3_exonuc_N | 2.94 |
PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
PF00085 | Thioredoxin | 0.98 |
PF01467 | CTP_transf_like | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.94 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 2.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.02 % |
Unclassified | root | N/A | 0.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10219828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 596 | Open in IMG/M |
3300001354|JGI20155J14468_10215408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
3300001589|JGI24005J15628_10083073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1121 | Open in IMG/M |
3300001938|GOS2221_1019956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
3300002518|JGI25134J35505_10096064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 653 | Open in IMG/M |
3300004097|Ga0055584_101808023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 629 | Open in IMG/M |
3300004125|Ga0066182_10139102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
3300004461|Ga0066223_1078017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 776 | Open in IMG/M |
3300005837|Ga0078893_10565845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1798 | Open in IMG/M |
3300006027|Ga0075462_10145688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 725 | Open in IMG/M |
3300006164|Ga0075441_10279418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 612 | Open in IMG/M |
3300006191|Ga0075447_10002195 | All Organisms → cellular organisms → Bacteria | 8908 | Open in IMG/M |
3300006484|Ga0070744_10163164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
3300006924|Ga0098051_1175858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 562 | Open in IMG/M |
3300007346|Ga0070753_1223874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 689 | Open in IMG/M |
3300007541|Ga0099848_1179892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
3300008993|Ga0104258_1074543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 633 | Open in IMG/M |
3300009001|Ga0102963_1063037 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
3300009001|Ga0102963_1455293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 502 | Open in IMG/M |
3300009024|Ga0102811_1384555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
3300009026|Ga0102829_1134058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 787 | Open in IMG/M |
3300009026|Ga0102829_1205853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 640 | Open in IMG/M |
3300009086|Ga0102812_10501299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 663 | Open in IMG/M |
3300009496|Ga0115570_10294387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 705 | Open in IMG/M |
3300009512|Ga0115003_10239672 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300009599|Ga0115103_1097266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 930 | Open in IMG/M |
3300009599|Ga0115103_1376303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 524 | Open in IMG/M |
3300009606|Ga0115102_10805080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1490 | Open in IMG/M |
3300010155|Ga0098047_10095654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1159 | Open in IMG/M |
3300010300|Ga0129351_1130035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1001 | Open in IMG/M |
3300012417|Ga0138262_1840893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1162 | Open in IMG/M |
3300012928|Ga0163110_10821767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 732 | Open in IMG/M |
3300012928|Ga0163110_11606308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
3300013181|Ga0116836_1005877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1068 | Open in IMG/M |
3300017740|Ga0181418_1089879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 747 | Open in IMG/M |
3300017750|Ga0181405_1057799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1013 | Open in IMG/M |
3300017767|Ga0181406_1034535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1581 | Open in IMG/M |
3300017779|Ga0181395_1093906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 963 | Open in IMG/M |
3300017950|Ga0181607_10657119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
3300018049|Ga0181572_10615798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 659 | Open in IMG/M |
3300020161|Ga0211726_10492545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1036 | Open in IMG/M |
3300020172|Ga0211729_11471771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
3300020175|Ga0206124_10091379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1271 | Open in IMG/M |
3300020352|Ga0211505_1089621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 736 | Open in IMG/M |
3300020379|Ga0211652_10241225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
3300020403|Ga0211532_10094743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1288 | Open in IMG/M |
3300020416|Ga0211644_10148806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 956 | Open in IMG/M |
3300020416|Ga0211644_10387890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 577 | Open in IMG/M |
3300020430|Ga0211622_10091146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1321 | Open in IMG/M |
3300020439|Ga0211558_10433362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 605 | Open in IMG/M |
3300020440|Ga0211518_10426069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
3300020457|Ga0211643_10186854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1019 | Open in IMG/M |
3300020457|Ga0211643_10679615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 502 | Open in IMG/M |
3300020595|Ga0206126_10376988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
3300021389|Ga0213868_10478721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
3300021958|Ga0222718_10285132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 864 | Open in IMG/M |
3300021958|Ga0222718_10371948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 721 | Open in IMG/M |
3300021959|Ga0222716_10369523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 843 | Open in IMG/M |
3300021960|Ga0222715_10456492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 686 | Open in IMG/M |
3300021960|Ga0222715_10467143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 676 | Open in IMG/M |
3300021960|Ga0222715_10604821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 565 | Open in IMG/M |
3300021964|Ga0222719_10250978 | Not Available | 1176 | Open in IMG/M |
3300022061|Ga0212023_1051251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
3300022198|Ga0196905_1006146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4194 | Open in IMG/M |
3300022198|Ga0196905_1181299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 533 | Open in IMG/M |
3300023176|Ga0255772_10481401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
3300023180|Ga0255768_10507647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 609 | Open in IMG/M |
3300023698|Ga0228682_1052506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 552 | Open in IMG/M |
3300023702|Ga0232119_1002266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2821 | Open in IMG/M |
3300024235|Ga0228665_1037920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 993 | Open in IMG/M |
3300024292|Ga0228630_1103272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 579 | Open in IMG/M |
3300024297|Ga0228658_1064505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 924 | Open in IMG/M |
3300024301|Ga0233451_10104123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1405 | Open in IMG/M |
3300024332|Ga0228659_1123708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 550 | Open in IMG/M |
3300024346|Ga0244775_10670743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 837 | Open in IMG/M |
3300024415|Ga0228662_1144843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 523 | Open in IMG/M |
3300024420|Ga0228632_1139014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 565 | Open in IMG/M |
3300025098|Ga0208434_1050021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 918 | Open in IMG/M |
3300025128|Ga0208919_1231447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 543 | Open in IMG/M |
3300025137|Ga0209336_10102826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 804 | Open in IMG/M |
3300025138|Ga0209634_1042465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2305 | Open in IMG/M |
3300025655|Ga0208795_1064520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1048 | Open in IMG/M |
3300025759|Ga0208899_1224256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
3300025879|Ga0209555_10038846 | All Organisms → Viruses → Predicted Viral | 2196 | Open in IMG/M |
3300025890|Ga0209631_10179199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1111 | Open in IMG/M |
3300026138|Ga0209951_1042437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 985 | Open in IMG/M |
3300026201|Ga0208127_1110226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB59 | 700 | Open in IMG/M |
3300026453|Ga0228644_1020103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1390 | Open in IMG/M |
3300026453|Ga0228644_1063699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 674 | Open in IMG/M |
3300026458|Ga0247578_1104683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
3300026470|Ga0247599_1003627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2848 | Open in IMG/M |
3300026471|Ga0247602_1008194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2513 | Open in IMG/M |
3300026505|Ga0228647_1019595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1797 | Open in IMG/M |
3300027190|Ga0208674_1012988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1342 | Open in IMG/M |
3300027631|Ga0208133_1111665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 636 | Open in IMG/M |
3300027714|Ga0209815_1266397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 514 | Open in IMG/M |
3300028125|Ga0256368_1085583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 534 | Open in IMG/M |
3300028196|Ga0257114_1154003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 883 | Open in IMG/M |
3300028282|Ga0256413_1303746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 562 | Open in IMG/M |
3300028396|Ga0228643_1004989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3740 | Open in IMG/M |
3300031629|Ga0307985_10153806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 914 | Open in IMG/M |
3300031766|Ga0315322_10059304 | All Organisms → Viruses → Predicted Viral | 2799 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 16.67% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.69% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.78% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.84% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.86% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.90% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.92% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.94% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.94% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.96% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.96% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.96% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.98% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.98% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.98% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.98% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.98% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.98% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300013181 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024415 | Seawater microbial communities from Monterey Bay, California, United States - 76D | Environmental | Open in IMG/M |
3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026201 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes) | Environmental | Open in IMG/M |
3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
3300026458 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
3300027190 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_102198281 | 3300000116 | Marine | YTYDSXLFDFNKEDSKETLVELQEIMEQDGKYPIKFKYSKDLVL* |
JGI20155J14468_102154081 | 3300001354 | Pelagic Marine | SLLFDFSKEDGKDTLTELQNILESGKKYPVKFKYSKDLCL* |
JGI24005J15628_100830731 | 3300001589 | Marine | KKTKVVLYTYDSLLFDFNKEDGKDTLKELQIILESGKNYPVKFKYSKDLCL* |
GOS2221_10199564 | 3300001938 | Marine | YTYDAILFDFDKEDGKETLKELQIILESSKKYPVNFKYSKNLVL* |
JGI25134J35505_100960642 | 3300002518 | Marine | YDAILFDFCKEDGKETLEDIKNILEEGKKYPIKFKYSNNLVL* |
Ga0055584_1018080232 | 3300004097 | Pelagic Marine | YDALLFDFDKEDGKETLEDLQRILSENGKYPVKFKYSENLVL* |
Ga0066182_101391021 | 3300004125 | Freshwater Lake | TYDAILFDFFLEDGKETLENLKKILEQGGKYPVKFKFGNNLVLD* |
Ga0066223_10780171 | 3300004461 | Marine | YDSLLFDFNKEDGKDTLIELQSILESGKTYPVKFKYSKDLCL* |
Ga0078893_105658451 | 3300005837 | Marine Surface Water | VVLYTYDALLFDYDKEDGKETLEKLQEILETGKKYPVKFKFSK |
Ga0075462_101456881 | 3300006027 | Aqueous | YDSLLFDFSKEDGKDTLEELQNILESGKKYPVKFKYSKDLCL* |
Ga0075441_102794181 | 3300006164 | Marine | ALYTYDAILFDFDKDDGKETLKELQIILESSKKYPVNFKYSKNLVL* |
Ga0075447_1000219511 | 3300006191 | Marine | LYTYDAILFDFDKDDGKETLKELQIILESSKKYPVNFKYSKNLVL* |
Ga0070744_101631642 | 3300006484 | Estuarine | ALLFDFYKEDGEETLDRLKEILETGGNYPTKLKYSKDLSL* |
Ga0098051_11758582 | 3300006924 | Marine | FITLYTYDAILFDFSKEDGKQTLSDIQTIMEKQGKYPVKFKYSTNLVL* |
Ga0070753_12238741 | 3300007346 | Aqueous | FDFSLEDGKQVLVDLENILSEADTYPVKFKYSKNLVL* |
Ga0099848_11798921 | 3300007541 | Aqueous | LEDGKETLEDLKKILETQGKYPVKFKYSNNLILD* |
Ga0104258_10745431 | 3300008993 | Ocean Water | MYTYDAILFDFSKEDGKQTLEDIKKIMEDRGKYPVKFKYSKDLML* |
Ga0102963_10630374 | 3300009001 | Pond Water | FYKEDGKETLEELKEILESGGKYPIKFKYSKDLSL* |
Ga0102963_14552932 | 3300009001 | Pond Water | LYTYDAILFDFSKEDGKQTLEDIQEIMEEGGKYPIKFKYSKDLVLD* |
Ga0102811_13845552 | 3300009024 | Estuarine | FDFSKEDGKETLEGIKKILEKDNKYPVKFKYSKDLGL* |
Ga0102829_11340581 | 3300009026 | Estuarine | KVSLYTYDSILFDFSKQDGKDTLSDLEEILSEGGKYPVKFRYSDNLVM* |
Ga0102829_12058531 | 3300009026 | Estuarine | KLVLYTYDALLFDFNKEDGKETLEELKEILESGGKYPIKFKYSNDLCL* |
Ga0102812_105012992 | 3300009086 | Estuarine | LLFDFAKEDGKETLLKLQEILEEGGKYPIKVKYSKDLLL* |
Ga0115570_102943872 | 3300009496 | Pelagic Marine | LFDFDLTDGKETLEELKRLLETSGKYPVKFKSSLNLILD* |
Ga0115003_102396721 | 3300009512 | Marine | AVLYTYDSILFDFSKEDGIDTLEEIKQILQTGEKYPIKFKF* |
Ga0115103_10972663 | 3300009599 | Marine | FTYDAILFDYDKSDGKDTLEGIQEILEQKGKFPVKFKFSKDLVL* |
Ga0115103_13763031 | 3300009599 | Marine | SKQDGKETLEGIKKILEKDNKYPVKFKYSKDLGL* |
Ga0115102_108050803 | 3300009606 | Marine | LKDKSTKPVLFTYDAILFDYDKSDGKDTLEGIQEILEQKGKFPVKFKFSKDLVL* |
Ga0098047_100956543 | 3300010155 | Marine | FDFSKEDGKGTLTDIKTIMENEGKYPVNFKYSTNLVL* |
Ga0129351_11300353 | 3300010300 | Freshwater To Marine Saline Gradient | DFSKDDGKETLKELQNILESGKKYPIKFKYSKDLCL* |
Ga0138262_18408931 | 3300012417 | Polar Marine | AVLYTYDSILFDFSEEDGEEFMEEIKEILQTGEKYPIKFKFSKDLCL* |
Ga0163110_108217673 | 3300012928 | Surface Seawater | LFDFNKKDGKHTLEEIKEILEEDGKYPVKFKYSKDLCL* |
Ga0163110_116063081 | 3300012928 | Surface Seawater | FDFSKEDGKDTLEDIKKILESDGKYPVKFKYSNNLVL* |
Ga0116836_10058771 | 3300013181 | Marine | LLFDFYKEDGKETLNDIQRILSETGKYPVKFKYSQNLVL* |
Ga0181418_10898793 | 3300017740 | Seawater | TYDALLFDFNKEDGKKTLEELQEILESGGKYPIKFKYSKSLSL |
Ga0181405_10577993 | 3300017750 | Seawater | VVLYTYDSLLFDFNKEDGKDTLKELQIILESEKKYPVKFKYSKDLCL |
Ga0181406_10345354 | 3300017767 | Seawater | LYTYDSLLFDFNKEDGKDTLKELQIILESEKKYPVKFKYSKDLCL |
Ga0181395_10939061 | 3300017779 | Seawater | KIALYTYDAILFDFSKEDGKETLQDIEKIMSEDNKYPVKFKFSKDLVL |
Ga0181607_106571191 | 3300017950 | Salt Marsh | DSLLFDFSKEDGKDTLEELQNILESGKKYPVKFKYSKDLCL |
Ga0181572_106157981 | 3300018049 | Salt Marsh | TYDAILFDFSKEDGKQTLEEIQKIMEQNGKYPTKFKFSENLVLD |
Ga0211726_104925451 | 3300020161 | Freshwater | TYDAILFDFFLEDGKETLENLKKILEQGGKYPVKFKFGNNLVLD |
Ga0211729_114717712 | 3300020172 | Freshwater | AILFDFFLEDGKETLENLKKILEQGGKYPVKFKFGNNLVLD |
Ga0206124_100913793 | 3300020175 | Seawater | LLFDFSKEDGKDTLTELQNILESGKKYPVKFKYSKDLCL |
Ga0211505_10896212 | 3300020352 | Marine | DAILFDFSKEDGKETLEDIQEILETDSKYPIKFKYSNSLVL |
Ga0211652_102412252 | 3300020379 | Marine | FDYSREDGKETLENLQEILETGKKYPVKFKFSKDLSL |
Ga0211532_100947433 | 3300020403 | Marine | YDSVLFDFSKEEKNILDDLENVLSEDGKYPVKFKFSENLVL |
Ga0211644_101488063 | 3300020416 | Marine | LFDFYKEDGEETLKKLKEILESGGKYPTKLKYSKDLSL |
Ga0211644_103878901 | 3300020416 | Marine | NVVLYTYDALLFDFSIEDGKQTLEEIKEILEETGKYPVKFKYSKDLCL |
Ga0211622_100911463 | 3300020430 | Marine | FSKEDGKETLNDIKEILETDGKYPVKFKYSDNLVL |
Ga0211558_104333621 | 3300020439 | Marine | VALYTYDAILFDFSKEDGKETLQDLEKIMSEDNKYPVKFKFAKDLVL |
Ga0211518_104260691 | 3300020440 | Marine | FDFCKEDGKETLEKIQEILESDKKYPVKYKYSDNLVLE |
Ga0211643_101868543 | 3300020457 | Marine | YDALLFDFSIEDGKQTLEEIKEILEETGKYPVKFKYSKDLCL |
Ga0211643_106796151 | 3300020457 | Marine | YDAILFDFDKEDGKETLEDIKNILEENKKYPIKFKYSNNLVL |
Ga0206126_103769881 | 3300020595 | Seawater | LQNKKTKVVLYTYDSLLFDFNKEDGKDTLIELQSILESGKTYPVKFKYSKDLCL |
Ga0213868_104787211 | 3300021389 | Seawater | LFDFSKEDGKDTLEELQNILESGKKYPVKFKYSKDLCL |
Ga0222718_102851321 | 3300021958 | Estuarine Water | SVALYTYDAILFDFSKEDGKQVLEDLQRILDQGGKYPVKYKYSKNLILD |
Ga0222718_103719482 | 3300021958 | Estuarine Water | KKSGVALYTYDAILFDFDLSDGKQTLEELKRLLETSGKYPVKFKSNTNLVLD |
Ga0222716_103695233 | 3300021959 | Estuarine Water | DLTDGKETLEELKRLLETSGKYPVKFKSNTNLVLD |
Ga0222715_104564921 | 3300021960 | Estuarine Water | SGVALYTYDAILFDFDLSDGKQTLEELKRLLETSGKYPVKFKSNTNLVLD |
Ga0222715_104671432 | 3300021960 | Estuarine Water | FHKEDGKETLEKLQEILEEGGKYPIKFKYSKDFVL |
Ga0222715_106048212 | 3300021960 | Estuarine Water | FDFSKEDGKDTLTELQNILESGKKYPVKFKYSKDLCL |
Ga0222719_102509783 | 3300021964 | Estuarine Water | LRDKKTSVALYTYDAILFDFNKEDGKQVLEDLQRILDQGGKYPVKYKYSKNLILD |
Ga0212023_10512512 | 3300022061 | Aqueous | IIDFKKEDGKETLEELQKILEEGKKYPVKFQFSKDLSL |
Ga0196905_10061466 | 3300022198 | Aqueous | YTYDAVLFDFSKEDGKETLEEIQKIMENQGKYPVKFKYSTNLML |
Ga0196905_11812991 | 3300022198 | Aqueous | YDAILFDFSKEDGKETLEDIKKIMENQGKYPIKFNYSTDLRL |
Ga0255772_104814012 | 3300023176 | Salt Marsh | LFDFYLEDGKETLEDLKKILETQGKYPVKFKFSSNLVLE |
Ga0255768_105076472 | 3300023180 | Salt Marsh | SLLFDFSKDDGKETLKELQNILESGKKYPIKFKYSKDLCL |
Ga0228682_10525061 | 3300023698 | Seawater | TYDAILFDFSKEDGKETLNELKDILESGKKYPVKFKYNKNLVL |
Ga0232119_10022661 | 3300023702 | Seawater | YDALLFDFSKEDGKEVLFGIQNILEKDNSYPVKFKFSKDLVL |
Ga0228665_10379201 | 3300024235 | Seawater | YTYDSILFDFSKEDGKELLTDLEEILSENGKYPVKFKFSKNLVL |
Ga0228630_11032721 | 3300024292 | Seawater | TLYTYDAILFDFNKEDGKQTLSEIQTIMEKQGKYPVKFKYSTNLVL |
Ga0228658_10645051 | 3300024297 | Seawater | DAILFDFSKEDGKETLEDIQEILETGSKYPIKFKYSNSLVL |
Ga0233451_101041231 | 3300024301 | Salt Marsh | TYDAILFDFYKEDGKETLEEVQRIMESGKKYPIKFKFSKDLVL |
Ga0228659_11237081 | 3300024332 | Seawater | AILFDFSTNDGKETLKGLEKIMETNKKYPIKFKYSKSLNL |
Ga0244775_106707431 | 3300024346 | Estuarine | FDFSKEDGKETLEGIKKILEKDNKYPVKFKYSKDLGL |
Ga0228662_11448431 | 3300024415 | Seawater | TYDAILFDFSKDDGKETLADIQKIMERQGKYPVKFKYNTDLVL |
Ga0228632_11390141 | 3300024420 | Seawater | TYDALLFDFSKEDGKETLEGIKKILEKDNKYPVKFKYSKDLGL |
Ga0208434_10500213 | 3300025098 | Marine | DFSKEDGKQTLSEIQTIMEKQGKYPVKFKYSTNLVL |
Ga0208919_12314471 | 3300025128 | Marine | LFDFSKEDGKETLQEIKEILETDGKYPVKFKYSNNLVL |
Ga0209336_101028261 | 3300025137 | Marine | KTFIALYTYDAILFDFSKEDKSEVLENIQNIMERQKKYPVKFKYSTNLIL |
Ga0209634_10424651 | 3300025138 | Marine | NKKTKVVLYTYDSLLFDFNKEDGKDTLKELQIILESGKNYPVKFKYSKDLCL |
Ga0208795_10645201 | 3300025655 | Aqueous | KTKVAPYTYDAILFDFSKEDGKELLETLETLLSQNNLYPVKFKYSKDYCLE |
Ga0208899_12242562 | 3300025759 | Aqueous | KSGVALYTYDAILFDFDLSDGKQTLEELKRLLETSGKYPVKFKSNTNLVLD |
Ga0209555_100388461 | 3300025879 | Marine | NKKTKVALYTYDAILFDFSIADGKQTLQQLEKILNQDNKYPVKYKSSQNLILD |
Ga0209631_101791993 | 3300025890 | Pelagic Marine | SLLFDFSKEDGKDTLTELQNILESGKKYPVKFKYSKDLCL |
Ga0209951_10424371 | 3300026138 | Pond Water | DFYKEDGKETLEELKEILESGGKYPIKFKYSKDLSL |
Ga0208127_11102261 | 3300026201 | Marine | YALLFDFYKEDGEETLKKLKEILESGGKYPTKLKYSKDLSL |
Ga0228644_10201033 | 3300026453 | Seawater | AILFDFSKDDGKETLADIQKIMERQGKYPVKFKYNTDLVL |
Ga0228644_10636992 | 3300026453 | Seawater | VLYTYDALLFDFSKEDGKETLAGLTEILEDNGKFPVKFKYSKDLGL |
Ga0247578_11046832 | 3300026458 | Seawater | FDFSKEDGKETLFELQTILESNKQYPVKFKYNKNLVL |
Ga0247599_10036276 | 3300026470 | Seawater | YTYDSLLFDFSKEDGKDTLTELQDILESGKKYPVKFKYSKDLCL |
Ga0247602_10081944 | 3300026471 | Seawater | AILFDFSKEDGKETLFELQTILESNKQYPVKFKYNKNLVL |
Ga0228647_10195954 | 3300026505 | Seawater | KVVLYTYDSLLFDFSKEDGKDTLTELQNILESGKKYPVKFKYSKDLCL |
Ga0208674_10129881 | 3300027190 | Estuarine | TKISLYTYDAILFDFSKEDGKETLFELQTILESNKQYPVKFKYNKNLVL |
Ga0208133_11116652 | 3300027631 | Estuarine | ALLFDFYKEDGEETLDRLKEILETGGNYPTKLKYSKDLSL |
Ga0209815_12663972 | 3300027714 | Marine | SILFDFSEEDGEEFMEEIKEILQTGEKYPIKFKFSKDLCL |
Ga0256368_10855831 | 3300028125 | Sea-Ice Brine | LYTYDALLFDFHKEDGKETLEELKVILESGGDYPIKFKYSNDLCL |
Ga0257114_11540033 | 3300028196 | Marine | YDAILFDFSKEDGKDTLSEIQTIMEKQGKYPVKFKYSTNLVL |
Ga0256413_13037461 | 3300028282 | Seawater | DSILFDFSKEDGKELLTDLEEILSENGKYPVKFKFSKNLVL |
Ga0228643_10049896 | 3300028396 | Seawater | VLYTYDALLFDFYKEDGEETLDRLKEILETGGNYPTKLKYSKDLSL |
Ga0307985_101538063 | 3300031629 | Marine | NKKTKAVLYTYDSILFDFSEEDGEEFMEEIKEILQTGEKYPIKFKFSKDLCL |
Ga0315322_100593041 | 3300031766 | Seawater | TYDALLFDFYKEDGEETLDRLKEILETGGNYPTKLKYSKDLSL |
⦗Top⦘ |