NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101983

Metagenome Family F101983

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101983
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 49 residues
Representative Sequence VTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVEALKTL
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 48.04 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.157 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.706 % of family members)
Environment Ontology (ENVO) Unclassified
(28.431 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.176 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.62%    β-sheet: 22.97%    Coil/Unstructured: 55.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04392ABC_sub_bind 9.80
PF00501AMP-binding 5.88
PF13046DUF3906 1.96
PF13103TonB_2 0.98
PF00005ABC_tran 0.98
PF00892EamA 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 9.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.16 %
UnclassifiedrootN/A7.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0746764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
2228664022|INPgaii200_c1079608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria644Open in IMG/M
3300000890|JGI11643J12802_11535712All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium546Open in IMG/M
3300000956|JGI10216J12902_100682332All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium570Open in IMG/M
3300000956|JGI10216J12902_120956168All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M
3300002122|C687J26623_10189918All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium569Open in IMG/M
3300002562|JGI25382J37095_10135926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium819Open in IMG/M
3300002912|JGI25386J43895_10015290Not Available2232Open in IMG/M
3300004157|Ga0062590_101506501Not Available675Open in IMG/M
3300005181|Ga0066678_10285777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1076Open in IMG/M
3300005186|Ga0066676_10045380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini2473Open in IMG/M
3300005294|Ga0065705_10247586All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1207Open in IMG/M
3300005294|Ga0065705_10489802All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium788Open in IMG/M
3300005295|Ga0065707_10662154All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium657Open in IMG/M
3300005353|Ga0070669_101290383All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005446|Ga0066686_10003898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini6865Open in IMG/M
3300005467|Ga0070706_100067027All Organisms → cellular organisms → Bacteria → Proteobacteria3320Open in IMG/M
3300005558|Ga0066698_10008756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini5419Open in IMG/M
3300005574|Ga0066694_10120088Not Available1236Open in IMG/M
3300005578|Ga0068854_101681970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300005615|Ga0070702_101044059All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium650Open in IMG/M
3300005615|Ga0070702_101852361All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium505Open in IMG/M
3300005718|Ga0068866_10408499All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005764|Ga0066903_101082958All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1475Open in IMG/M
3300005764|Ga0066903_108662506All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300006058|Ga0075432_10132921All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium944Open in IMG/M
3300006163|Ga0070715_10102727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1336Open in IMG/M
3300006844|Ga0075428_102128447All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300006847|Ga0075431_101557424All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium619Open in IMG/M
3300006854|Ga0075425_102623851All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300006969|Ga0075419_11533266All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium501Open in IMG/M
3300007255|Ga0099791_10326166All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium734Open in IMG/M
3300009100|Ga0075418_12396068All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium576Open in IMG/M
3300009156|Ga0111538_13215559All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium569Open in IMG/M
3300009162|Ga0075423_10365739All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1513Open in IMG/M
3300009553|Ga0105249_10405894Not Available1394Open in IMG/M
3300009807|Ga0105061_1055577All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300009815|Ga0105070_1041462All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300009820|Ga0105085_1055985All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300010029|Ga0105074_1079213All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300010046|Ga0126384_10447334All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1102Open in IMG/M
3300010329|Ga0134111_10009107All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3131Open in IMG/M
3300010335|Ga0134063_10282139All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300010359|Ga0126376_11957205All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium627Open in IMG/M
3300010361|Ga0126378_13332582All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300010362|Ga0126377_10412259Not Available1365Open in IMG/M
3300010366|Ga0126379_10687192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1116Open in IMG/M
3300010401|Ga0134121_12961559All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300012198|Ga0137364_11175344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria575Open in IMG/M
3300012199|Ga0137383_10144256All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1742Open in IMG/M
3300012205|Ga0137362_11197547All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria644Open in IMG/M
3300012206|Ga0137380_10881912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium769Open in IMG/M
3300012209|Ga0137379_10513200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1107Open in IMG/M
3300012349|Ga0137387_11229876All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium527Open in IMG/M
3300012353|Ga0137367_10076208All Organisms → cellular organisms → Bacteria → Proteobacteria2483Open in IMG/M
3300012356|Ga0137371_10925367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria663Open in IMG/M
3300012922|Ga0137394_11286883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300012930|Ga0137407_11668572All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012930|Ga0137407_11734745All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium595Open in IMG/M
3300012944|Ga0137410_11773695All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300012948|Ga0126375_10362677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1033Open in IMG/M
3300014965|Ga0120193_10061327All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300015371|Ga0132258_11012306All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2100Open in IMG/M
3300017656|Ga0134112_10123969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria982Open in IMG/M
3300018076|Ga0184609_10247888All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300018422|Ga0190265_12491654All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria616Open in IMG/M
3300020170|Ga0179594_10144125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria879Open in IMG/M
3300020215|Ga0196963_10363714All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300025930|Ga0207701_11479829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300026089|Ga0207648_12207722All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1511Open in IMG/M
3300026326|Ga0209801_1150995Not Available979Open in IMG/M
3300026360|Ga0257173_1024455All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium774Open in IMG/M
3300026480|Ga0257177_1007349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1392Open in IMG/M
3300026524|Ga0209690_1176265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium718Open in IMG/M
3300026537|Ga0209157_1002455All Organisms → cellular organisms → Bacteria → Proteobacteria14780Open in IMG/M
3300027490|Ga0209899_1030553All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1172Open in IMG/M
3300027511|Ga0209843_1054987All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027646|Ga0209466_1092338All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300027654|Ga0209799_1123736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium589Open in IMG/M
3300027695|Ga0209966_1044115Not Available936Open in IMG/M
3300027874|Ga0209465_10587361All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium552Open in IMG/M
3300027880|Ga0209481_10632030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300027903|Ga0209488_10438109All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium963Open in IMG/M
3300027909|Ga0209382_11374084All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium711Open in IMG/M
3300027909|Ga0209382_11821208All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300031152|Ga0307501_10172780All Organisms → cellular organisms → Bacteria601Open in IMG/M
(restricted) 3300031248|Ga0255312_1049567All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1006Open in IMG/M
3300031561|Ga0318528_10447594All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium693Open in IMG/M
3300031719|Ga0306917_10254957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1345Open in IMG/M
3300031740|Ga0307468_100556082Not Available925Open in IMG/M
3300031780|Ga0318508_1047793All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1125Open in IMG/M
3300031795|Ga0318557_10404374All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium628Open in IMG/M
3300031820|Ga0307473_10020885All Organisms → cellular organisms → Bacteria → Proteobacteria2664Open in IMG/M
3300031820|Ga0307473_11261568All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300031910|Ga0306923_10418478All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1523Open in IMG/M
3300031912|Ga0306921_12211778All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium579Open in IMG/M
3300031944|Ga0310884_10033175All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2201Open in IMG/M
3300032025|Ga0318507_10009229All Organisms → cellular organisms → Bacteria → Proteobacteria3171Open in IMG/M
3300032059|Ga0318533_10303801All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1158Open in IMG/M
3300032091|Ga0318577_10413934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium644Open in IMG/M
3300032180|Ga0307471_103244701All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium576Open in IMG/M
3300032205|Ga0307472_100716946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium902Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.98%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_074676432228664021SoilVTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDVETLKTLGWQIAQDLAVLPAR
INPgaii200_107960832228664022SoilVTLYFFERITDDDFIGPVIVAAPDEAAAWNVLASRERADVEALKTLGWQIAQDLAAVPA
JGI11643J12802_1153571223300000890SoilVTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDVET
JGI10216J12902_10068233223300000956SoilVTLYFFERMTDDDFIGPVIVAAASEDEAWRLLAARERSARPALETLGW
JGI10216J12902_12095616833300000956SoilVTLYFFERITDDDFIGPVIVAAPDEAAAWNVLASRERADVEALKTLGW
C687J26623_1018991833300002122SoilVTLYFFERITEDDFVGPVIVAAPSEDEAWTLLAQRERQDAEALRALGWQIAQDLATLPS
JGI25382J37095_1013592633300002562Grasslands SoilVTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAIP
JGI25386J43895_1001529013300002912Grasslands SoilVTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQIAQDLAAMPAR
Ga0062590_10150650133300004157SoilVTLYFFERITDDDFIGPVIAAAPSEDEAWRLLATREQSERGALE
Ga0066678_1028577713300005181SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKA
Ga0066676_1004538053300005186SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLTAVPSR
Ga0065705_1024758633300005294Switchgrass RhizosphereVTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGW
Ga0065705_1048980233300005294Switchgrass RhizosphereVTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERTEIDALKSLGWQIAQD
Ga0065707_1066215433300005295Switchgrass RhizosphereVTLYFFERITDDDFIGPVIVAAPDEAVAWTVLATRERSDVETLKTLGWQIAQDLAVLPAR
Ga0070669_10129038323300005353Switchgrass RhizosphereVTLYFFERIADDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIA
Ga0066686_1000389883300005446SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLT
Ga0070706_10006702713300005467Corn, Switchgrass And Miscanthus RhizosphereVTLYFFERITEDDFIGPVIVAAGSEDEAWRLLAARERSARPALE
Ga0066698_1000875673300005558SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLTAVPS
Ga0066694_1012008813300005574SoilVTLYFFERITENDFIGPVIVAAPSEDEAWALLASRERSER
Ga0068854_10168197033300005578Corn RhizosphereVTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARE
Ga0070702_10104405933300005615Corn, Switchgrass And Miscanthus RhizosphereVTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLAA
Ga0070702_10185236113300005615Corn, Switchgrass And Miscanthus RhizosphereMILYFFERITDDDFIGPVIAAAADEDEAWRLLAQREKQEVDALKDLGWQIAQD
Ga0068866_1040849933300005718Miscanthus RhizosphereMTLYFFERITDDDFIGPVIAAAGNEDEAWRLLAQREKQEVAALKDLGWQIAQ
Ga0066903_10108295843300005764Tropical Forest SoilVTLYFFERITDDDFIGPVIVAASDEAEAWAVLATRERAEEEALKTLGWQIAQDLAALPSR
Ga0066903_10866250613300005764Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEA
Ga0075432_1013292113300006058Populus RhizosphereVTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERAEIDALKTLGWQIAQDL
Ga0070715_1010272733300006163Corn, Switchgrass And Miscanthus RhizosphereVTLYFFERITDDDFIGPVIVAAPDEAAAWTLLAARERSEVEALKTLGWQIAQDL
Ga0075428_10212844733300006844Populus RhizosphereMTLYFFERITDNDFVGPVIVAASSEDEAWALLAARERSERAALETLGWQIAQDLA
Ga0075431_10155742433300006847Populus RhizosphereVTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARERSARPALE
Ga0075425_10262385133300006854Populus RhizosphereVTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLA
Ga0075419_1153326613300006969Populus RhizosphereVILYFFERISEDDFIGPVIVAAGDEHEAWLVLARRERDAVESLKSLGWQI
Ga0099791_1032616613300007255Vadose Zone SoilVTLYFFERVTDDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIAQDLA
Ga0075418_1239606813300009100Populus RhizosphereVILYFFERISEDDFIGPVIVAAPDEAAAWIVLAQRERSDVDAL
Ga0111538_1321555933300009156Populus RhizosphereVTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERTEIDAL
Ga0075423_1036573943300009162Populus RhizosphereVTLYFFERISDDDFIGPVIVAAPSEEEAWRLLAGRERSEV
Ga0105249_1040589413300009553Switchgrass RhizosphereVILYFFERISEDDFIGPVIVAAGDEHEAWLVLARRERDAVESLKSLGWQIVQELTSWPSR
Ga0105061_105557723300009807Groundwater SandMTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEALKTLGW
Ga0105070_104146223300009815Groundwater SandMTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEAL
Ga0105085_105598513300009820Groundwater SandMTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERAD
Ga0105074_107921323300010029Groundwater SandMTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQI
Ga0126384_1044733413300010046Tropical Forest SoilVTLYFFERISDDDFIGPVIVAAPDEATAWSLLAGREKADVEALKTLGWQ
Ga0134111_1000910713300010329Grasslands SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALK
Ga0134063_1028213923300010335Grasslands SoilFERITDDDFIGPVIVAAPDEATAWTLLATRERSDVEAL*
Ga0126376_1195720513300010359Tropical Forest SoilVILYFFERITDDDFIGPVIVAAPDEAAAWTVLASRERAEVEALRTLGWQIAQDLAALPSR
Ga0126378_1333258213300010361Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAPDEVAAWTLLASRERSDVESLKAIG
Ga0126377_1041225913300010362Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARERSARPALETLGWQIAQDLAAIP
Ga0126379_1068719233300010366Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAPDEATAWTVLASR
Ga0134121_1296155923300010401Terrestrial SoilVTLYFFERITDDDFIGPVIAAAADEEEAWRLLAQREKQEVDALK
Ga0137364_1117534433300012198Vadose Zone SoilMTLYFFERITDDDFIGPVIVAAASDDEAWRLLAGRERCERAALEALGWQ
Ga0137383_1014425613300012199Vadose Zone SoilVTLYFFERITEDDFIGPVIVAAPDESTAWTLLATRERSDVE
Ga0137362_1119754713300012205Vadose Zone SoilVTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQIAQDLAAM
Ga0137380_1088191213300012206Vadose Zone SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQD
Ga0137379_1051320013300012209Vadose Zone SoilVTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQ
Ga0137387_1122987613300012349Vadose Zone SoilVTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGREKSDVEALKTLG
Ga0137367_1007620853300012353Vadose Zone SoilVTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTL
Ga0137371_1092536713300012356Vadose Zone SoilVKLYFFERITAEDFIGPIIVAAGDETEAWTLLSRREGQSVQA
Ga0137394_1128688313300012922Vadose Zone SoilVTLYFFERITEDDFIGPVIVAAPSEDEAWRLLAARERSERP
Ga0137407_1166857213300012930Vadose Zone SoilVTLYFFERISDDDFIGPVIVAAPDEAAAWTALASRE
Ga0137407_1173474533300012930Vadose Zone SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGR
Ga0137410_1177369513300012944Vadose Zone SoilVTLYFFERIADDDFIGPVIVAAPDEPTAWSLLAGRERADVEALKTLGW
Ga0126375_1036267733300012948Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAASEDEAWRLLAGRERTARPALEALGWQRGHTFRWRKSG
Ga0120193_1006132733300014965TerrestrialMTLYFFERITDDDFIGPVIVAAPDEAGAWTLLAGRER
Ga0132258_1101230613300015371Arabidopsis RhizosphereVTLYFFERITDDDFIGPVIVAAPDEATAWTALASRERSEVEA
Ga0134112_1012396933300017656Grasslands SoilVTLYFFERITDDDFIGPVIAAAASEDEAWRLLAARERSQRPALEALGWQIAQDL
Ga0184609_1024788823300018076Groundwater SedimentMTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQELTA
Ga0190265_1249165413300018422SoilVTLYFFERITDDDFIGPVIVAAPSEDDAWTLLAKREGSDRAALEALGWQIAQDLAAIPA
Ga0179594_1014412533300020170Vadose Zone SoilVTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSERPALEAVGWQIAQDLAAMPAR
Ga0196963_1036371423300020215SoilMTLYFFERITDDDFIGPVIVAAASEGDAWGLLATREGSDRAALEALGWQIAQDLAAIPS
Ga0207701_1147982913300025930Corn, Switchgrass And Miscanthus RhizosphereVTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLAAVPAR
Ga0207648_1220772223300026089Miscanthus RhizosphereVTLYFFERIADDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIAQDL
Ga0209801_115099513300026326SoilVTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERA
Ga0257173_102445513300026360SoilVTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAIPPR
Ga0257177_100734933300026480SoilVTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVE
Ga0209690_117626513300026524SoilVTLYFFERITDDDFIGPVIVAAPDEATAWTLLATRERSDV
Ga0209157_100245513300026537SoilVTLYFFERVADDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDL
Ga0209899_103055333300027490Groundwater SandMTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEALKTLGWQIAQDLAAIPPR
Ga0209843_105498713300027511Groundwater SandMTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAI
Ga0209466_109233813300027646Tropical Forest SoilVTLYFFERITDDDFIGPVIVAAPDEATAWTVLASRERSDVEALKTLGWQIAQDLAAIPSR
Ga0209799_112373613300027654Tropical Forest SoilVILYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERAEVEALRTLGWQIAQDLAALPS
Ga0209966_104411513300027695Arabidopsis Thaliana RhizosphereMTLYFFERITDNDFVGPVIVAASSEDEAWALLAARER
Ga0209465_1058736133300027874Tropical Forest SoilVTLYFFERISADDFIGPVIVAAPDEATAWSLLAGRE
Ga0209481_1063203013300027880Populus RhizosphereVTLYFFERITDDDFIGPVIVAAASEDEAWGLLAARERSQRPALEALGW
Ga0209488_1043810933300027903Vadose Zone SoilVTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEAFA
Ga0209382_1137408433300027909Populus RhizosphereVTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDAETLKTL
Ga0209382_1182120833300027909Populus RhizosphereVTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARE
Ga0307501_1017278023300031152SoilVTLYFFERISDDDFIGPVIVAAPDEAAAWTALASRERSEVEA
(restricted) Ga0255312_104956713300031248Sandy SoilVTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVEALKTL
Ga0318528_1044759413300031561SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQIAQDLAAMPSR
Ga0306917_1025495713300031719SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQI
Ga0307468_10055608233300031740Hardwood Forest SoilMILYFFERITDDDFIGPVIAAAADEDEAWRLLAQREKQAVDALKDLGWQIAQDLAALP
Ga0318508_104779333300031780SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQ
Ga0318557_1040437413300031795SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALR
Ga0307473_1002088513300031820Hardwood Forest SoilMTLYFFERITDDDFIGPVIAAAGDEDEAWRLLAQREKQEVDALKDLGWQIAQDLAA
Ga0307473_1126156813300031820Hardwood Forest SoilVTLYFFERISDDDFIGPVIVAAPDEATAWSLLAGREKSDVEALKTLGWQIAQDLAAV
Ga0306923_1041847813300031910SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERR
Ga0306921_1221177813300031912SoilVILYFFERISEDDFIGPVIVAAGDEREAWLVLARREGGAVESLKSLGWQIAQDL
Ga0310884_1003317543300031944SoilVTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERSEVDALKTLGWQI
Ga0318507_1000922963300032025SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRER
Ga0318533_1030380113300032059SoilVTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQIAQ
Ga0318577_1041393413300032091SoilVTLYFFERITDNDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTL
Ga0307471_10324470133300032180Hardwood Forest SoilVTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGREKSDAEALKTLGWQIAQDLAAVPV
Ga0307472_10071694613300032205Hardwood Forest SoilVTLYFFERISEDDFIGPVIIAAGDENEAWRRLARREGDAVESLKALGWQIAQDLAGL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.